(o!, 9 3 99@@PH!@@T*@PĠʌ!G:pB W7a>  @! %X!L! $?00H0O!T4: @^OOID0)00000*0"9 & 0606060|$00 4P PEp` `5$Z`0` @OPD@pP5 0@Tp -LKM K⦌P 00 <" p-L`P@ P PPp0@T:p -L :0ģ00S0 P@0T @}0S 0#Q00 p`0@000T @}0S000Hx P4040,000!!!!#"b <"YQ -0LS  00  -0LS 00  -PM0LSc @T, Q "U@P @"O` K@TV V:T000S5  QP0P, P+ K`P'=.P ppW@a e7PPWY0 Q ! ,0S0S, 80 , QPT,0 00 1   0-L1MLK 44 >t} &m 1\ !0@0`3<0[R00!PQ 0@T00&Q*@sa0S000gt@r  oH姢# fl `! <"<"<" ##P"P"P"@0 -L@0T: -L =?00_G  -L0 0 -L ፆ 0  -0LS 000p  -0LS 000p  -L@p DMQP@0P`` FP@p0S KW   00S  0-L@0P@} 0P@ l0,R200SR  >Q  0,R200SR0鴯!!! - 0L - 0L p-0LP@U ᖄ0S 0T,S00D0S^I`TP ` }0 S 0 S 00D`P00p -L`$M P0@S9  0p000ᗞP̌̌`l@5 ``l\j5Lፄ0S05$m"!$!P u.=?0$34 000,, 0  ;괯! -L`pXHMi00%HS%< h$fT%,0000 NP WK; \@KNPjt a -p-L@KxM  0`P r0 0`P!<@Kp }r `P00000 urK 100 000 jr0Z TTp -L  0  -L @Մ -L`p P@Pc ,| E1,10S0SS8`≠C(1-P1 0R  {0,$,!$#,/ "e+0Pj0?0#e  1,m11 SST 0c #h0R`I`PD 0 -rom1fsLE=(|S -L, KHM8 D  @ z( /P< 8 /P0dpP< P <0 KqP0 00000 0 W{ FPsh4 KqP040040 T8P4p 4Q8ޟ_0۟^(؟[PT``HpG( PD4@1@ W0U<U" 4@<`P@` 尟/P4@8 D/P4嚟 +0 <+0 @ 0D p犟@ 08#8@0 PUH借 _u/<s/(g 04dT -<0L0@S (Z! %(T -LM  L   cR b @K c 0p0bS V X 0`0tS K M 0P0uS @ BZhK L0` @00pS hK 0` @ hK h0` @@K 0HP08_e /00hKg D -L@ P 0}x 0P\ rP ׁP < 4 ΁0P ^LPX\dh 0-4@L $0$Pj00鸯!!p  -L@Q MW1崡 d 嘁!.  q.|+ ta`Q:@u,zPP 㣘@P(K 0T+P :PZ+,᭗D.B. 0 S k+D0 ;  :P<P13@ -t`@(h& ㄗX!TPxp !!P!!!$ oP-Ua -L @ T -L4 -L -L -L -`00LSL0L@*.<0P 00 @!$!! !!< -L0pP尀 @/ P `0S00圝00 P*0T 0$01 P$D#:0@ 00 (!!!8!! !d8! -Lu 000!! p-L0 @P0 0000000@@PPNp |`P @gigh00S@@p@6p$! !!!! !(!8!!!! -L00 AT -L`@p T (  0 S S  S S  0@ 0@ D H 10 0!000 00P0  "10"!   0 0H0 0p1(P0( @00D0 0T18P08 P00T0@ 041HP0H@L00 &X0PS 0 Q @X0000S0 Q 0 0 0 0 0 0 0100 L0x Q  0#10T0Q g 000v8lATATATATATAL!AT AT -LZ -0LS  0R0001SAT -L @!ҟNOЍ a@I(F(FF(F(F(F(F(F(F(F(F(F(F(F(FџNOЍ aIFFFFFFFFFFFFFFF$џNOЍ aKFFHFFFFFFFFFFFFПOЍ aJ`:PppB 1 p hhh̠ @Bp@ @٩ 1@ @Щ0`P0<T -L&1M01R* rR: BT1TTTTT00L1L!A1001@,,!T A⎔T6 P <̠  `@p p儩 =3>à  {P0@ 0 P20w0=80000040\ P"@<h!!"0@@e!0"@e"0"@e p"|P||0||#`@@ `@@ peLL0"Pe 긧 !D0!lDD -L @p`0\#V* 00S0 00. "&0#6S:R 1S0bS!* @T:\  % -L`P 00 P 0PU**@ p0S 00 0 0Q0S0000 >0#00S "&0S 5Z1 @0PU:\p0PU *@0S `h  @0PU:0 60+P" -LP㔀p 0R` P@^*0  0 0QV0 P ^:u$@$ M000 p-L`P8@808  c $)} &y p+ %@ -L4`KPMU8 8 "80 < 01 0C`@R(J0ST@+ J 0Xp00S0 0 F p0X0T8 `F@TZlP< 0?R0S L@@$ 0< 10 0008 0Z 00+ ## -LP@h d M$m  > <(0S ᯀN@ 0T+1P0pK<`K "&C R0  0 < P 0 0S 0 0#&B 0P< 0 H08 0@T*n1#6!P0 H R $0S (0S 5n++P"!D 0  a2a217caA}P" -L\a\\M0 S1"&01 !2b217c! bB!1a !1`c p0PU 3S @q 0000PUp`00 @TP 0 P0""6000@T`0`!(5)%0D*5P" P" % ++!P" -L0! -LP0 1  -L 00 P -LL㴑@P> 0Q `2`217c `@d|pP 0!000! `2`217c `@N|PP 0!000!WU d```d|b|@`X 8j0 000 c\P"| -L,@,0 00 M0?   -L,@,0 00 ;0?   -L$$ 0 0 0/   -M 0L00S 10   rR rT @ 0p  #+>;0 !30 %!0 C, 4 &$*Q04 ` 0>C 8 R ` 1 zG8 00$5J ?46S4046S  W*  X vG4 ,00$* FW* W*:$*Q04 ` 0>C < R  1 }zG< 00$5J ?u W * -L`@  pP0V 0S 00010 0 0 P 0P2040q600 0P@ T00V03S 0&* f,  0@`3F?6C#jjV1< 0 :0?=C 0 0 00 ~~   0- 0L@P@ 0P 0 -L0PX8`0V/*@ 0S% 00S!p0\\ ,Ơ 0 60t Ό!.  l(0 0>0 @0`V:0X+P"+ -L ,,0M00 0P ! p-Lxn`P p i` o`P  HPHH@H08< 0p pP  =1 . = O -L 00 -$ 00 00000L0 -@0L S S  S S (N: 00 0@ D H  -L0 !   B  -L͠L0L ^<< <0 0 0 0 DZ! p-L0A 0000 0`0C00C00 00C000S0S !000!00`0s7 PP 0 0 0 0 DZ"P0 0000 0 0 DZ@txqp@D`A`X00S/0@00p ! !@lL! -L@@b0S|0Sw0SrL! -LgP cDt -00LS Q0|| 0.0C0Q00e0C0000C00000L!pq -L7 tt3MhHp!ဠ0P@`p`q, <#<000a0C0@00"00000C0000C0@00?0C0)000P@a@P0b0000d000`@0p000p$pG0@00a0@P@0=0C?C`000q0C00000@PPp,  ,   X00,0耠S0000 pX1,T!, X00`?0PA!0b0000d0000p00f0C0g00o0C0000C0P|0C0000000PP0!}!00pq$!: -L@0!m}! -L@@@3 M@g43@@,@D{gt@3c0@0qg!T00kgR@@@eg000C0_g0`4PK0Yg"0Ug2 0R  &`V00@T@@R00Ag4B ``:g000 4g`/g00000)g`%g 000g`g00a g!0l`00 g 000Lg%~`8ga $fp0!0`00f pf00tf`0 f0pG`fa00fp 0`00f lf00Xfc0H0fw L 0b0(0f000 f|yy xef -<00LS # @0!|!L! -L X\ LQ,0\ 0 < 0S - L -Ld0$P 0P P P  0 0, -LMB0(R ʔ0R R &|0R t0R' h0R \0R F>L0R D0R  ZZPe  P0< 0H -L< KMϰ [A0@S0 0CdP 0[ 0C0d -,00LS  000L! -,00LS  000L! 0-L0PM?@T <0S | h㒋`0`< 00#6.ư00 @ T* 4 1 S200`Q * Q *4 1 S2Q:,@  @ T:PQ  T0#0% ^, R) 00S%00C p W00gX *000 0 00 60a a>0#600 0 0C0 0& a 0:#: 0:#: F 0a0 0T *HdP00,0 @0T:X c -LS0CS` p"C V*01 S2`b00p,@ W:`p !6C!"V0t 1#6 0A*`a00op ,@"6C1>0#W:00P" -L -L -L -L -L0 0 +P"P" - 0L+ - 0L+ -Lt+ -LPP0p@`T  0PCTc P"@ -L@PR@ -(00L#4S 00 00P"P" - L8 odT -L M @p, 00 ʠ,ʠ\00`P01`VP0 S `1`V c,h T0!0 1@822!0AP0`,@ 24 H C@ S# p b2b217c! bB!8 #,0,!40D0 00q0 R< @ 10c@0 4p< Ɔ<00@S4P1A 000,04000 <0!$S*0S: S1# 8#8SL(L$L"L!L  1l00`V *0  0   0`V:4@0 #@f,00P * l.P"P"p*20P!0 4HP^00 00-J1e1e1 @ 0 `00S H 000"H0 0@fH0000000000@@ @D܀H`F JPUZ 8"6;;S0 0!  < `V*8` 0P0Q@00D0,4 0 4<0a@@,< `V:` 9 xcPPp0S! @`c hcPY 0  000  000 P @0SX0,S0S 0 0  (! 0-LP M0 00t@l0T@``\ @P0P L@&P,p H@|Pz"ȅHN؅P0 -<0M0L ((( 00{ P HN@ L -LrPP WPbP# &SS -L c0t|" -L c0x|" -4@L& P5,p0 q" -LC-Y p-L@0` 0``000 Q000B0`NPU(P8pP0$`Q(0 !0QpP -404L@  !P04@80r" -L808 40@@$ P04@80 r""T -L,@ P04@80"0 -L\0?S0S0S\0 S 0 S \0S0S  -LP@`p b0000C S0S000S000C00S 0  -L@`@Kp$P$M~Z 2=80 Q Q 1S S!H08@0 0TLS8 00080 OU EU reU oU80<80 80<80 0rS80180 d^08` ,80 0 -L -L0lAll!lP1Q`1`Q 001011`((q(((QV$a0 P01^$PP@PQD01TPX``ptPPl00PPx00PP00PP 0000 dhP0XP010Q0[P /~ UP x)~ "Ċ"TL!܁"  d """" `   h @ 8 (  < $0\ -L2M=Pp"M 0 0(0 f0$0 R< 0 W  K$ K,0K0(0K  R# ʖR KR K R  R K R  R \2R @ @ @@@(B$B @(0S @0@$0OS ES eS oSLL00S @ S  S P0PPPpP@0P 0P 0l!P  R& R R R  R R R  R R 1R 0R KK  K  K   00#`]` 0 LĠpp@p `0d0N0P0ڽW q` ҽL!tpl  㽽 -L~ s - 0LS3 0p`0P 0`0 00@0Q P2d00 l @1P0x t0S1P0800SP04P0 `pPWsP"8sxs4s p-L`@PDD0`0<0 p@ 000{P@TpP"xs ( 0-L=@M0 0 0 !f00 $0 R01ā1L 02cQP K K 0K$K 0 $PP"0 -Ls}s 0-L00#SP`@P0s -(Lw@P 厠؅ -L@M D @ 000 0 : 00K'T -L88 *P (H|@0( -L`WTT@$W@ V<00 000 "<Ċ"; -L`QW0 01@!@1`㰁aaa00 0+P ypA `V010ᰁaa000P yI@ KV㰁0㲡aḁ000P |yt@ 6Vh0ᰁaḡ000P @xy5)p"T," 0"Xd" -LLL } 80 0  000$\Zp" -LM, T# -L <1M, 0S , ,0S1,   AU0? 10!1 0 01 P`p帀帠 000@0D 0PX`Pd`hpTtp x0 0| 0x x0 t l0 XP Xv##'#Ċ"T| } z 0{ z '####| T{  { (| h{ x{ 1! \ |1 |F Q  Ta A$D1 |0  w0 0000 Y 0<0 S 0 @ 0 0 0<0S 0,0   , `\0X@xDD 00x8y #l <"####, $4# p-<`L1PU @! i1PUp'# -L4"$0!>Qڼ0 0P S  pP`@ 0P 0@ 0!00C0!TPDX0X SL0'#()#!'# %Ȭ % % %, %IJ A4)# -L0t -,0L  0C 0Rd -Ld@p @T -LOPBR@Tx -L UP; P5  P P P& P P ` e  @   PD  P4 (0P 0Pp 0-L` dPd0M֌T00S P <wG ((@(0]Itȱ 8` 0 -L0Ю p-L0 @0`Sp P0! d 00X Z00H0  0C 0 0`ow$Q@T!p\!d`x -LP pb@Px`lPP R0e @@@ 0004 00 :w ()#d( -LKM K_P0 100@ -L㰍 0)# 0-Lp tPt@0M)P\pwB"0@H@P ,vp F0hp(  ᰣP04@8000S 0 @@ 00!l0  \ 00000000!8 ;0,v 긱 D)# pqX0 p-L0 M0S[ <&  8& 4& PK&(K`@$` (@ &=?0@h&x@P:d P\0PT080L|v& D&q&000@: S L!$)#8 @!lf 00 L0  $0 Nvбp -LX :$M  0Ps#  10[R010K S RSD Rp#L00S 10[u2 K"20[020K20[PU@TfR p-LT0P0`S@00S@` ph#R 0-LPK@ (MbM A0P @T0 -LL LL0L@L 010P0$ ;S0#8L#K# -HH HH0H@L 090P0< S0#L#L# -Ltt tt0t@P 0^?0oA0SS  Px00eA0SS #PM#M# p-L`0!X@XP 00L00 S 00L00S !p!pv( 0-L@X0X Q-AL00  08 0000000 @0000#  -L@G> 00 \3S0S  S G P408 ,00/ 00 #x#|## -0@L@ @R R R     H0D0 @ "24 S0000 S000  -LBM0 S 0 PR00BP P|R#BP P `R[@[@P @q[@P@Qb@qj0@q ` qR ܑ0\3p@Y@|@a1 0Qd@@ PP P10Sxt Q%_@P TQV@DX !000000 0\30 0000p0@    Xq`vI 0Q0#3ZT+ 00 000@'@p=q(pt#x#Q|#t$,4@HRXl# , ,0(3 q.@@0T: - L-J -L@@ KM 0@#0 0 9X -Lp@0Q00& ``PBP lPp`00`PS0@00  0(0$#30 00罄t -L= M R? `0 p3x# 0 0@0 @ 0 @( K⯕L$(0Rx4$  ? \\\\\@\P\`\p\00 ÊCScs샊 ZLZYUW8VX YdYVWDX -L -`3"0LR ʨ0R 0R00S00@4L4S ?h hh00 ~000SH 0@00808 04#3000:gjRUWt -LL0 LR 0@0W@TX0 xV4## 0-L@PP LPUd0 -L@Pp=P>U 0S `RP 0`FSP"1101P0xS 1S 121`0PPU  0;S,S@,`P0S TP -L`C MRP0=S  RP x RP  RPLoe@RP0o0(#0RP3@@ hR0dS0`ShSpK  aLp12g% \O@mRP %Rr0lS0uS0nS0 K0=PS00S81<]:oZ 0 K0.PiVVVVVVV|VhVTVDVVVUUZZZV0000007C/p00d!\0000000(@o00@000@00000000000000 0000000 00  000011,0[ 00 0([!00P >000      4 @ # #0 8 th 0iS0dS0eS bR0uS0sS0 K0P0 0B.S2 n00B0S@KL H0 K0`d0pFg Qw@ 0 S\3St tWt t/0F!2c/1Syen0Sq$YZZZZZZ,Y@YTYhYYYYZ ZZ$Z>n!000i!0@00dl!0 00_\\0 @00@ 880 0@0 @ 0 K0' 2c! P 000000; 000600?0,0 0(0 \ (0 0,0010 RP 00@( 0\3 @ ($ # ,#h txm mh  -LL@ \8k404 00 AQ m\X0 0-ƍC0 -M@LTC , 0"S?^pK(0 <(0}a[V  㧍 r ៍1[S 0< 0$ x0R $$`K r$pW L $㞍$ g$ ᖍ$0S D00\  :000C0 -L@LM`  \ ($XK0C`d` P@p@ UP  EpT@h 0Sl0 8 0\ 0` S2 W 0l 8#8S B B B B BB Q h0  0gl  `QP!000d0Q0d0 @p Wh0, 0"SH0d4H0 Pp U d0 \^ 0 00C l0S1X0K1d Q 00C l` `$C 00C0 p-LP @ `T @T0S $(0LS 0   SJ,Np 0-LPP 0S 0 ' 0S @ PT @T0 0-lP@LT @TDP@T @T$P@T u@T0x -L@`=pPK M0[0CS00K [p00X0 -L0Pp@`T  @T - L⢘Z! -L hhZ! -L ]hZ!D -L @  Qh Mh[!([! - Ls@[! p-P10L9 S  S  S $!00 !00!00fp@fA IQP@fp`0Sn0P R@^Qp0S40phf0S 0 088006600440p<X[!iiiL!jj $(j -L8 00P(080 ;0j8 $:d9[! 0-LZLPL @P  ,0(0Zf 0j[!< $[!j -L0 00 \! $ -sL#\#300 S &2 "\ 80 " 00".90z^꤂B2":0zz|"0M<2 8R\"000P".90 2 \ "90,("!00bz2!"00Zz1!0\ 001! 0 01!000!00\0 ꤁HH!00@!:01z@!00x pApa 020 @`0 P U 0P@0S0S  W0 0 0CS A00 l0@PT0 00#0k $ $ $ $ $k(\! $ $kD\!`\!$\!k|\!k\!Pk\!UUU $ $ \!## p-LP ؑP04P80@  0\P xdp`0@T`00@T@P@00S  P@TpxlHcl!$|l$ -LM( P 0S H GPP(0 ( P (K HB( 0KSkS500(0 ( 0,St0(0 ( GP(0 ( 0Sf @P0SP0P00CS   0b0@>TR(X G@P(0( 0S (K sH$1@!0S@(0(K0-S(  cH0@0@ܠ0 S* @`pGP( qGP,(0:S(XGP0 Q 0d 0000S (l\n!lS$l$l!l!l$ `@T (00Tn! -L0 9R0R1000C0 -L` M S40 , 0 \"14 H2 RZV(2`Vy Gp0@0 H0 P@W80 <0 D /J09S0S(-S 1@S xS ,pY0(0S& U$H pU0)0S D UP@ @TZU0?S < 8 @X/ X)*4PQ  FPFP 80S 0<S 0@ S T 0HS,0D0 P4P X:@TZ,0 0P dTn!0@T *4P ,0 0P4P@T: -\DM0T"1L@ p8 P<  8 \00R0S\00R0S' @PdUP^a 0(1^0 401 0!400 40`0 @@T8^DD <8 81RD @1,0S 0XS 0Ss 80H ,P8Sl 53Q0Dp@O` ! H5>l\.  \  @ T1@ T230p`VZ<OX=#$n!s. 8  0B S00S0@8r'` !@0H#"5>l T.1@ T230@0H 5>l T.1@ T230p`VZ<OXp8 P{0Sx4@K 80d\01L0 <Dp@h 0$0C0P#\0 ,000C0Q#`0 80< 0CPP R #T @X@ hLO`!0 @0\ PR \0n2㠱\0㠡 @`0\0T `0l2à`0à @d0X0U 0e2#%L0S 0   L\  ^ms.L@T1@L230Tp`VZh< OXh p80SPDp@?'` `V2"200Z<OX p8^PDp@  O`0`V0Z<OX p8Q70S4=@S0S@( DP@D Pp X000@0c6<H!2"Y0 0Y0 0 `0`V0$0Z < OXp80SE0SBDp@PP!0d 000 0C000`@PVA!F Y@0#200b3 P0d00`@@0 b00P" 0'V@d<OXd pXWY0X0CYP:@1,0S W A?OAhm -(L)@P @o! p-L`PM|ß|||#|3a1p!Q0CSL|@d|`04CL"2;Q H" *;8B="#;O8";,Q1/S4c@@D;t/1"S431"S411d"S/1L"S 40`1S Ÿ!1`!01Rj A =! 9! 5!1S  .!0!R40$40!0!R400$400` !0!R400$4000!R4100$41001S% S S0!R00!R400$4000!R 400$4000!R 400pprptsloxssF$4001/S40!R400$400 0 ! 0R400$4001/S41/S41/S41/S41S 1/S40!R400$400 0 !0R400$4001/S4 0!R4 00$4 00 1/S4 1/S4 1/S41/S41/S41/S40!R400$4001/S40!R400$400!R004 1"S41"S41"S41"S41"S40!lR400$4000!@R400$4000!R400$4001S 0!R(0!R 4 00$4 000!R4 00$4 00 1d!S41H!S4! R4R 4! R4R 4! R4R 4! R4R 4! R4R 4! R4R 4! R 4R 4! R4R 4! R4R 4 ! R4R 4 ! R4R 4 ! R4R 4 ! R4R 4 ! R4R 4! R4R 4! R4R 4!R4R4!R4R4!R4R4!R4R4l 10CSP 0!@R4100$410011 S 4P 0P&? 0 0P @0@ 0P  0@ 0P 0@P 0P  0@@  0P  0@  0P  0@ 0P 0@E 0PUrg]sp -L/P4P\ 040 R@ R R 76E]6t -LP`@P00 0p00 O~@P `P U  p-LP`@PM 0]Ut`p` `0]VX<T< <0\000h0  |00`0 pptpt t t`00|000S  0\ pp uptp p-L@PM0Pp\5K-70ST XP ,,`0qP\uPuXu T0qPH 00 aG%Q0  1\\8q!uup -L0\\rM(0 \(KP(0S,Ÿ,,,",2t\(0 !!S Ÿ !1g\1( 0!S _\Qa!A1`@*( (01<1?0P2唡1!@'倁,H@1!Uh10d!1\!\X!X ?  48!?PPP@PUڠ` 1Q01r6 0T0Z> 0!@P7  c6!5"l@P%'uU$ pp vp vlo 0v$p!Xvp!X\p!$eip!t؆\p!,p!T$@,+,P p!܆$  [v -LP M& 0S# v0S `p@@Kl0l B>PP0`p`V<>P0 00?PP v p!v$p! -tL[h JF\aQP[ D|[@1 !!00QS@@$@0@<@@1 1 0!1  @ TP 500p@  "$ 0 qHQA,p@1!b"P;d 5[FPw $lww@q!L$P8$8w-@r!<w -XL[P[H 01Q0@B0xyd$t!$ -L :``M  P0PDZ@00 S4404 440000z$zP"4u!8u!$$0T38 -L@ )P 04@80s -Lc_x! -PLJYHk@0P4Vユ$N_ 00D0H$h~!$}! -L10 0 \^霖$ -L@$0L \~! -L$Œ0PY|! -LL0L @ D  @@@ "z,0, ᵅP0 0 $`o"  -L 290 S0P 0 00  | 00  d 0 \孔X嫔@H စP<04@80Ā!!@B$  ܀!!ܐ -40LQ $0 0000 0$x&H. -0LC@  OP04@80!xN -LqP a#"M0#4#0#0@PV4 :PP'뼀P, V0#'RP0R:51 C|@0 00C C0 H`PPEUP (U<"P"Ȣ$t$$H !X$$ R #X0xS00  00Q0L00C\0 0 000\0!0020H@ `0 00Pl80000y0@a80000 y@ 㟄P0 0 㘄Pp0 0@d ᐄPX04@80W갖Ģ$$x$$DV$xT$tX܁!!o"QdS 0-LTKHM>D0 S 000D0 S| 000D0 Sd 0C10( P:  X@0匁8P4@80, 000x!$!<"!0 -LL+[<@< 3P,0 0( ,P0 0D!o"H 0-LT@ :DM@@42P(T :@@ 2PTx :@@1PT10PS$!%1RP0R:5#2 CA 0 00C C 0 xPPEUPDT 0P !00  0P:51@SU0 T0SPUZST0P !00 0PU#p ppp90E:CX 10P ;0#ꌩ $̩$ܩ $P"Hx!H! ! !Ue 50 000 S1R!0 U< 50;50<500 0C0 ʐ 80 :C0x0x  wVh H@0Lu 0@0D0AHL0D0B !!! !$!h!RUt!@$0 -L9 3I?8<000΂PU?00h@0  P8S  00!0C30@̩$! -L C0P SLX$ -\@LMyLYH0H ӂP80 0(,0 00{ \!!o"кDԺ! -LpP9`3I?80`<0`0`0   >`0   M@0 2PT}S 00 @00 03 ,0`0z_@pWZ̳$dX -L<_44@[, ,007l|\ppp!!$ !! 0-LQU@㚹P|Ux㓹PhUd㌹PTxUPㅹP@qU_0PS 4\0W:0WY@ ᱀Px0 0t ᪀Pd0 0` ᣀPP0 0:CDS0鄨! !h$!!ب!o" $ -L}N -H0LS 86P(S$ $$00P!X`  %nD tzD tzdi tzlB? <B? <B?T<B?<ATtATATLATATBT$ATXAT ATAprofile=debugquietnoinitrdload_ramdisk=rorw @@!@!"@"8@89@9X@XY@YZ@Z[@[ 0@P`p|xtpl h0d@`\ X T@ PL H@80( $@$ -- -0-./&'cHH H0H@HPH`HpHxHlH`HTHHH<H0H$HI JKLMNOhh h0h@hPh|`hpphdhXhHh8h(hhhhijklmnorr rt0rh@r\PrP`rDpr8r,rr rrrrr000000x0l0`0T0H 0< 00 0$ 0 0 000]] ]0],,,,+root=rootflags=rootfstype=prompt_ramdisk=ramdisk_start=nohlthltreboot=fpe=root=1f04 mem=32Ml??bATATkeepinitrdnoalignnocachenowbB"@""{"z"y"|"j}o7 aX,Et:s9t(t$@t(t(panic=console=reserve=memfrac=lower_zone_reserve=  HNHNdevfs=lockd.udpport=lockd.tcpport=kbd-resetpsaux-reconnectpanicblink=ramdisk=ramdisk_size=ramdisk_blocksize=?=pci=DUe7@^7@^^^p^˄Xf3S8a3S8a-<_0p<_P<_q<_7`q`q`q`q`q`G`Q`9U_9_x_x_1x_v`H`d@0bW0bqte{jZvyb6ׯ%y=hȜ˹f^ʶžʐnJ&.pF|b֣tாΣm2P[zV|V^jRYd^ "*6BNJV&F.2R:e^>tb{jZb\N&rW׸*{Eכv\NFfzkʐy|n6̎z d/pFnQrzjn"v6vQRV "*6BNJV&F.2R:e^>tY{jZ.   = s - 6<&  J +    "jr "ʐ<,nj[,> Z > .N6X$:^E 2.*CH_.$2F."L:"B4B !!"""!!! !"#$%&'&&%(#"! )) !#%*+,---.,+*%("! ) "$*,/,00$%'+,/12%#! ))) "%345!66666666!+/,0(! !$3-'666666666666!1-2$! ))) !(*4%6666666666#2'!6*-*(! ) ) "&,566666666666%/72"651'" ))) #*/"66666666666&885%6!-+$! !$99666666666666%+0("66'40# )) !&-&666666666666""666666-3(! ) "0/#66666666666666666666+,%! )) #*4666!"66666666!#"66666(4'" ) #2/66!!$'!66666('"3$6666"/*# ))) #2/660:8$$666#/;<=0%!6666/2# #2/6#>?@:"66!ABCDE>#!6666/3(! ) ))) #2/6+D@FG566&CHIJKL.6666615$! #246MN%/FJ"#2OP!1QRS6666615$! ) ))) #*/!:M!1TU(0+KM6#2P?66666.9$! ) ) ) #*8#7U6(:VWWX ? ?   `?p wpwpwwwpppppwnnnnnwnnnnnnn``nnnnnfffffxfffffwpwffffwwxvffwwwwwwwwwpwwwwwwwxwwwxwwxpppnn`n``nnnn`n`nnnnnnnnnv~nnnnnnnnnnnnnnn`v~nnnnnnnnnnnnnnnnn`vnnnnnnnnnnnnnnnnnnnxnnnnnnnnnnnnnnnnnnnnnxxnnnnnnnnnnnnnnnnnnnfgx`nnnnnnf`nnnnnnnnnnf```nnnnfffffnnnnnf`ffffffffnnf`ffffffffff`fff`8`o0p p\pTp@0 `Lp X X N`@p0 netdev=ether=p|XԈĊPhФ ,4<@ DLTldxl145<<<,Shz88lpH$l\d(p    $ Hd@ \ !#67X::K8N8[\\\HihivvwHwww4yyԧ,p, Hh -L 6=?0  c|  -L0 0 ~p0`   % 0-LX"=?0(S6@P t!:UGd PTa<  @0P 0,($ :hp!0 -|0@L7l0420.nD  (( ~p `0 !! x   % -PL0 #4SSM ppR0  `00ro @x0@ 8 d`00巚00P P 0 S J괯! #!< Dt W X00S cP<0)5 :@8p̻ -LlKMt x D|% 5 ZtxU !0PU00l0xSPPM @h0 S% @T1S 5E S015 ,0PSPU l0K1S 04U 5 \!T *l0K1^ J@T :l K0Q Z@hKVKAPU 00lE  0PU@@Pt@T VKAAR.K B0 BQ00xPU:PRKJJ %5U pU P aRʐlK Aq %!% 5 \d %5hQ!@h0$0R   0B l@5T c@ T*0 R045 P^ !0Q0 00 0 0%K VKAA5 <d00 `pP a0N15B1% Rʐ5xh <dR>K0C0C1Z0#c`#* |R *R  0`'88  |5 c 0`'8 8p0,55HT*11@ T:0 NB P%@P%VKAA80C 4!%5 B0Cn5 80C%  0SAq 7%5 R% $ڈ\^ -L@P @D@^T -LM, 0 XXpTP`04 8 < 4V*$$30Q*30 00vAv4 `V:8,01@PT$cTq 0@D7s`cV*20Q*20 00vv`V:D"00 01@PT0T7s`c 2 00 X1!T V*10Q*10 00vv`V:`d Vt!00 07t*XX10Q*H10 00vΛv` V:<001@PT&cT{0@D7s`cV*00Q*00 00v꩛v`V:t 00 01@PT07s`cV*<<00Q*,00 00v ,!!0!! !!!v`V:`d0 0 b0Pc7tXXIh9eU@ T @! d0eS:d0 P@0 @T0P0 X0qZ!!0 p`!,!0! -L␑吡吁P@p`5V@fTpp10Q*`10 00T T@T@D,1T`%X  10Q*00 00TT@T00V%X@D00Q*00 00TT@Td00Pp Wpp%T@D`Fv0P@p,!0!!! !!! p-L@IM MI.K B01@TT 01@T0TI.K B01@T TI.K B01@TINK@D@DIKNNInK`F 0P @P@P,@TI>K0C 0C JK0h0hL@T ʜ$4 @P Pp -LQM M@`T30Q*x30 00dGd@T0<0b@DT05 30Q* 30 00d,d@T0b@DT045 20Q*20 00dd@T&b@Dpd"40\00P0SPPU*  20Q*20 00dd@Ta1@D!PUQ>K0C:UQ.K1 BPU01QKAAQKIIQK@8   80pP WC04 5!0 W,% * 5T*00Q*00 00dꛙd 5@T:,% 0!$% P6e@ePUQ>K0CpU.T4400Q*$00 00d 0!,!! !!Ljd@T P&a@D0SPuW Q>K0CpPEuOU8TLL20Q*<20 00dAd@T Pa@D0SPu- Q.K B01pPEu$10Q*10 00dd@T  Pc@D0S` Pu Q.K B01pPEuWT:Q^K0!1PE`@!1 8 pP WBpQKL L00(5 04 RKLpP Wx($VT$ %(5Z@PI$G ! !!,!0!P -L`q@PT00Q*00 00TꔘT@ 0P@DT000Q*00 00T|T@T0%Q@DSP@S.S0!,!! !! -LP`PpP 000M0 @K4 00G$KPP E!0!,!4!=$0S 0S0$0C0 S B R! -L0 1 P0cÌ`00 Q 0 #  0" Q!P 008!8! -SsM 0LR*3000 0 KR*T3000 0KR*$3000ٗ 0[S0[SS "P 0R*20`00`    0R0205: 0R0205: 0R0205: 0R0205: 0R0205: 0R0205:# 0R*10@00ꀗ@0Q*10 00D sD 0R0205:j@Dt 0010Q* 10 00RWP 00Q*00 00REPP P X@ >(>0>北\`\p 0R*L00P00#P0Q*00 00T ! !!(@`t T0Q*810 00XX0Q*10 00\\ 0R*00@00@0Q*00 00DזD0Q*l00 00HʖH0Q*800 00L꽖L000U !8! 00T  !, -Lp@`HPM(0S P0, 00  o@`TP Vg@! 0-L \0 1cA"P0S 0 !(P(0!U0,P 000 R P 0!(0(P!0 *400@! 0-LP U0 1cA&P0S# 0 4P0 0000 !((0!Q P00S 0 3030@!$ p-L`081cA0P 30`P00p@!D -L 01cHpQ@0` 03002@00000@!p 0-L0D 1cA0P , 30 @ P0000@! 0-L04 1cA0P  30 P000@! -L0H 1c(@T 0  P 00 p3@@! -L0H 1c(@T 0 P 00  U3@@!, -0`1L@! -L@3T -L04 1cAP00 S $@! -00 1cP0L0 S  @!HMB HMBHM BHMB<@  HMX"H4P【 ! [!@iHMqHP4@`Da741. + ( % "  @   !"# O@iHMp`HP4@  !@iHMX H4P【 ! !@i    HM(plJ:l;ĺ|DOlM$RQHDPpRRltZ<4TL%0004HxhUcHj<j4\\DriԐx\,L ԋ0.8p RĺphR,]^TȶX`(R_QX0Rt@BLdLԥ PM lL eh  uHrSa$X$x P  v W` 0]^n0w b0  > * x < `\P -L -L4 2!@0!00S0!鈷! -L2`APp0!0Sx /0CS00000 000S 0  0!鈷!x  -LP`p0@T 01 RZ p 0Pd` @PT 00Dp`#V,0, Ph餷!\!! 0-P@0(LP<0$P:0P* 0t 0S 0,00S,0Pm/0P00 0<0, $00R(00,00<" -L@`p000!P 0P@T p00! -L`2Qq0@00 20S/0  000SPU  0S00 0 0R00  pP000鈷!\! -LpM,P K PP$0$@K@0@$  0A 0T0c2`48@Q`$ $0KR  R 0Sꈷ! 0-0L0PP?3#Ph@000pT 0S  R0C0 @0$ 000.0  8" ! -L@0CP0 0$0(0 0C,0R `2`48@鈷! -LPp0@ /0"`0!0Q 0 0!0QpWP 0  00#300!鈷! -L`#Vp 21   W00 (=YPPU r@P  P PPP 鈷! -L#\ 2|!0 l .00ޖ@0!0 P 0S  P -!鈷! -Lp 1!^ !AK00!@P`  00S0000pDP@#T00!| 0 00bS00!@ 0 0pG00D @#T00! !<" -L00! \0 0D Q00!(0! !ј鈷!  -L00! h0  pD #R00!(0! !q鈷!  - 0L00 ! - 0L0C0 ! -L00!=?00S00S00! ! p-L⁡=?0 $ x B P0P`PL0UPM?@0S @>h$!l]p -L 0 -L$000S (! -L@20sSA!00S 0000C00000C8 B000 d0` :0000C 00C00:04@4@Dt$, L!pq<hx4 p-L@ M@`*04< 8 0,PPP,($ 0, 0,  0,z Z c0C0vVVnNu,=?0ttt p @0\@\ \@01L P_,@/?Z, T$<xD4t|p -LpP@ Mh00S S S f`d`e`?`P @p   p ,R ? P#,W`d , -L4P (H 0 0C0t,!0! -L0Q$0 H 00㪟0!,! -L -L -L  M?@0 A60 0  -L -LH 0pT`l2*(PF@( @4:0(0$0 0$0SHL -L =-? @T t  -L0?,`l080X040~p\p< 0Cw#6L0L @P CÜ0T0 e. "&@P 3g#6T0H H -L0 x@ 80 -LP =?0P 0S 3ʀS  R:> 0R00P:(0P0S T -L~ 0!1Q -L!4  ~-0 0!3<0 3 2Q HfPfXf`f0Pp -L~ 0030Q ffff0Pp p-LP$R0`M0 Z R R Rj RO R : S@~=00@0 Q. ( Q Q Q Q Q {Q! Q Q sQ Q mQ j0g0$e0`c0da0_00\0`0Y0d0V0T S0P0N!0SKG@  o @@`%B9B S4 0@   !1@!20!4A0D@@@ K06J UU33A3sQ 00 p -Lp`M@P0J0S J0 p-L@M`Q0Q8 0    0KP0`000)p 0-L0MP@  K0P1[ S! | [0) K0P (0R | 0)D0 -@~=00 M      (( (((((  (((( T-PM?@ 00hP43S H1pLSU k0P H R <R 0CR  r 000<0D 0C <00 KpZ l0S @0 rR 0R<0D 0C <0Z V p-L@ `KMlPP=?0 0  003S ?\ Pp -L `@$M]?P 0  003S@K @@KT0, `+@4@p"&D <80(2W00S x00  `  @P , D0 0 0e,0` T ᓶ  -L@0P`Mp Z020#S L00  M?@,\  0Z,0@   -L@M=?0 0  003S$K @$KT$KX  -L @PPŸ @MP񟗍ꌍdddddddddddddȎ,8L  Iq AEl\i PP 0c H^  0BX^\S p=?0 0  003S(`K  ,pW >(0 rC7 0 kC0w@, @'^   ,0KkOP,.=?0 0S  0ZO O  L M -L0 40 -LQ40 -L0 40A -LP`p@t 00@0$m" -L =?0  -L@`p[%2 W020#SM 00  @ 峵`P M?@,0 P0 0 0d,0@ V 9  -L -L -L 0-LP@0!h0`0` 0Q2a11D0 0!4 P= @ @0P00<"DL"<"?B -L@00!00 `0 0b"c11AQ0= 0CQ0P0HHH H00 800@ 00!<"DL"<"%%;"% -L| |00Bt00 āPX00\LL@ =l8 0# 000 `C<"l%M'ů p-LP%D00@!0P ` R 000bS0@0 0^P0E`` Vd@T: 0  b2b217c! bB!06 20 `2`217c`@pP ,0fT%6!0Q *T00:㥊,@T:ᙊ 8"P"P" -LΠP < 0s0S    p-L|0` 0S00. 2#6H0"&A1 QT*,@T:p 8"P" -LR ̷ķ00   -LM=?0P0  U -L -LP@p00\1 ` P  @0yM?@@, D -L  -L`p':1 @Q/ &?0;1'%/P 0 M?@P0\  h, P0R L -LP`0 0c(@4 T#v T00 R0S 4 W : 0C b#R0*(@TX Y =?0 P0R   -L"Ơ0`0p\#* 1 0A0S PP ` 0 a2a217caA 0P"P"P" -Lp'  M 'A00 < , 8 < W0#0%8  040 RU TV@ ,0< '6D0 0gD0Y#%6CD0 U0#0%0  H @ XP 0- DD0F% 0e`Vf#T0#0%0S H  `J00ST: |]006#Z@0Z0@0 U0#03U0SS 40 6#zz8 <0 WW8 :4 -L@P0CP0#03UXz'zP :@0PdxP $ ` 0hP x -Lx -L@oPP' 0 0 p 0 ?0KA}W`P *L P㐈   0-LPP R  \ O@K0 0A00@00Oh0! 0-=?0,0LS 0S00 P@@P U:0  -L@::S008  -LP`p @0 |@0 v@0 p@0 j@0 dx0@ p0p1\@@e@T@CT@@P@P!! !! !!$!4 -LR FP 0AQ0! -L0c06S!7<0 0-L00 S,6@2 0 S1`/ 0  @00  0 S @8C10#40Q0  P0R10#4000!L -L0Q00.6@ @0  0 S" 10#40#40#40Q 0 10#40#40#40Q ! -LP`M5SA1 p0  "1 @""<0t<0 00%7<0,0 0"41@H@0%0@Z   0@M@0# WI   0 SD  10#40#40#40Q7@( W%   0 S UU33! 10#40#40#40Q @,0B9B S<00C<0<00C<0 -L`p M@0<Ph "000$<0R0<0 R PR R. K,0"B0A1&J$J1"0A ` @R30 R R `R C4CTCS@0@1@tC1 PPD 0d>P =?0, `< 0L<=0 w 000'|| 000 =?0 | P0`  ?; !(8 !!!8 00? 0@ )Q@- !-R @- !:t 0!RXQ! D4Ġ!Ɍ 0 12 3Ġ!Ɍ 0 12 0A S:6 :6 P:20A S: : @Q::6 P:A Q : : @QZ/A Q : : @Q:: P: 0AS0?6 P:?0?16?H1Ġ   " Ɍ 0 10Ġ   " Ɍ 0 1 :!.  .U.  :StrongARM-110StrongARM-1100StrongARM-1110`| ` `@` @`| `4`@ @armv4v4 -@0 1L0, -@0 1L0, -L0 00! -L 0 00 00! -L0 00! -L0 00 -L(0 00 b00B0C0 -L0 00 -L -4 0L 0   40 !8: p-L` @0000C00P%PP00S P0 ``V00`\\ 0000 P80< ``V00 00pp$!q -0 0L8: 0-PL0@000 00 @0~ { x0(! 0-L00A00$!00 @ @T00 T00@ @Tʸ00TP@00000@ \@TP00TH0 008 000C00:&.x,h* -L0!Pu8Hh(Hh0 00[!00V|| 00 O\\ 00  G<10C0!00>10;!006003 00.00+ 00&00# 0000 00|00 p 00\00 P 00<00 0 000000 00 !,!0! -L@0!PrDdt(Hh 00 X!00S 00 Ldd 00  DD10@;010;$!006103!00.00+ 00&00# 0000 0000 0}0p00 d 00P00 D 000!,00 @0!0!4!8! -L -L0( PR  \ ,0S S$ 0b0σ(0S  P ,0S S$ 0b0 0`S00@ -L0@ !0<0S 4 4<00< 0000 !0! -LpwM.W   =?0 x-? 0PKH`H@0000 $  @(@ //0pcW<" -(0L0(0 -M=?0P0LS0m?`|2P 00S ` 00T22,0 00!(0S \< $0<0cC10 02< <0 0S S0S00!0 0C0<D  <0 00<00<000pAxqxP <@0( PR  0S , R R0$ 00b0?SpP^00!H Q 0$ 00 bB1 0H Q00!,0p0804000!U: ll 000, RP@P0S P@ 0!000! 8"@0!<"@!P0S00T ,0S P0 0!00C0!S 3P(00(00S0 -LP- 0!P@pT$ 0  `0! <0S d d<00< 0000 u !R 0 PU @T!0! -LP1 0!P@T( `D0  p0! <0Sp p<00< 000080 : !R 0 PU @T !0! -L0!000@PpT$ 0 `0! <0S d d<00< 0000  !R 0 PU @T!0! p-L` M00!Q&8@K ]?P4P (K(00(0 0 @K@ 0  @0000!X00!0S 0 0 0 0 000C000!p p-LP0M-? (P $ 0`0! @K0@ 0 00 @.00!  0 0 P P!p p-LP0M-? (P $ 0`0! @K0@ 0 00 @00!  0 0 P P!p p-LP0M-? (P $ 0`0! @K0@ 0 00 @00!  0 0 P P!p p-LP0M-? (P $ 0`0! @K0@ 0 00 @00!  0 0 P P!p -L -LP -? 150<0P )q'-? $0(Q0(0s0S0$0 -Lp`Q0?SMep@]?P 0  003S$K l@TR00!V F4&; #;! R |0SpP9 X(pX3$0pcS/X  S00R'p0S150 <0 R -? 441Q 01Q 15 0<0!Q ($0p00000! -L -L  -LP=?0 @4 ;8 #;! R |0S0S(0! -L Q0?SM'?0P @4 ; #;!! R |0S0 S 00 @K 0  003S \   -00LS ?(0S0(00000!<<0< 00<00< 00!!0 -L =?0  -L =?0  -L0P P0c00 -L0P P000 0-LP@PM;P? @4 ;L #;! R |0S\ (0$00cC1 ! x0111B"c#b1130  \  0  003SK ?\P PQ0 -L@  0S 0 8#8SA(A$A"A!A R1  =?0T Q$ t3S0S A0| |0d 0S |  0S | t 0S d| H ,0SD < 8 (,4<H -L@@N21 32 21 320 21 320 21 320 \00W0^000 0-8LE 00@B H@$PT LH@T0T -L?00!H L0L0L H0H0 R00 R00 000000L0HL0HL0 0S000l0< $ ( 1!0 !00z?z?.00! % 0-LM?@0000C\2TP\$#$#0!000!(#(#0!000!0 -L @0! <0S 8 8<00< 0000_ !0! -0L000! 0 000 ! -0L000!0 0 0 ! -L0! 0 0000 ! -L  =?0|h <0S K?0D10RH4!90,(A?| Q 0S 0S 0S0 00S<0SK?0900S00#Qڌ 0Sŀ 0Rl0S Ō 0RL0S ň 0R,0S HP 0!T -LP000x`p,p@T 000000C0T@T @pp0p!! -00Lo@P ! -L@ 0!00C0!Sx 0S0000C00 00 0P 000000C0qP 0!00C0!SOP*! --? LP 00 -LpM?,`011$1 1(11,0P0V L 0!000!P02 oPP  \P `,` 9, P0Ral@@@@d@t@x@,000  000000 00P 00,0`VK 0 Dh1Mo@PD D P 80Q:0 0 0!000!0  0!(10C(1!(0S(0( (0,0(0(@,000@ 000 000, wB00S 0S Z `VO=?0, P0R,%Z,PPP!!!  -L1@nP\ 000C000Q 0!(00(0! Q 0S 0!000! Q 0!(00(0!Q 0S 0!000!0S Q 0!(00(0! P 0S 0!000! 00  ! -L P0@1S  -LM=?0(s, Wp  0!000!f,0(1 [nPP] 0 0; 0 0000>0 @ TD tPH` VFP<V@@A  V Q 0!000!P00fA  0S0fS0bA T1 ,0(S    0n! 0-]?P(CLT@0S |0S 0!000!0ZP (C0 0-]?P0LS x@0@@x0Ix0T00x000 -LHß`  P$M< @ D0 F   =?0|0S |PP M?@/2 R:2Q 160 <0 R140 <0 R  !0!000!!0!000!442 0R0S $Q 0!000!0$ 000d0S Q 0!000!d0 0000K0x0 @0 x0: 0P|=?0|0S <@000 80K4 K08 4 00K00? =H@00 0P001T0  0 yPM| =?0$#0!000!@m%!!<"=?0!$ClP[ 00p00Q 0!(00(0! Q 0S 0!000! Q 0!(00(0!Q 0S 0!000!0S Q 0!(00(0! Q 0S 0!000! 00P@@$T  =?04#0!000! 0`lP4 !!?,0044P@P_P< P@00D0^Pk?KdBh 0l0p@ d 000 0 00S 000|匀0  0 00!000 00 000 000 l"H L0L0L0HPLP 000S0P0P|0,C4#;#;0S0 00P00000!0  R-!0Y00 8K|g,cV ,C 0!00C0!S@lPP 0!00C0!SC)0S $Q 0!00C0!0$ 000d0S Q 0!00C0!d0 000!0!00C0!( 0!l20Cl2!SW!! -L@@0T004 00000}>0k !! p-L PM?@t0`S u0 ,0R p  ,pd p-`L@PT M 0U: 0U$P(@T8@K\ 9@T 0U: 0U$P(@T @Xp -LP (0S4 0S S (0S0(0X -LD0S Q (0(S(00(X -LpM?@0`Vtp $0S 0PV $Q 0!00C0!$ 000 $$3 Ptp`U $Q 0!00C0!$ 000 p-LP`0M@`T 0 0$04S( 0p(@PTU:X@,p p-L@t]?Pt` V t0Sp --LP 0 @0m 050 0S -=?0|0S%ꅙQ xx@/Qh0"c1A@Dt H@D=t00!@!$! 8"8!S0@00C0T 9\ #90@ S0S@000 00T 0 p! -L```@ 0 0c SL0 9L08 0 0c S9L0$ 0S007"7"?!7"7" --@10LS 01  B   000`0!A 0, pR" P0S <R0/S7S0>S <00>000 Sh 00 RH0!^ !ASK R !0 $D!D!7"! -P0 0LS0040!^ !AK 00 8"7" 0-L@P0!0 0 0a@P !h0 `0! !у!T 000S  i07"7"7"7"D! -000LS -? 0S 00y7" -L:x -L|0!^ !ASAK RH0@D0T 1 0S $@T!7" -餁L0@S1S01ı0S P10100Ha0pS- PP Q00 RQ001ı R 0P!010010W01PpW0S1 1d0 RT 0$0@$0$0$@1 0! 000!H!!7"7" 0-L@` PR$0PE0 $0S S$0P$00S 000! 0-LP@P l0S 0 l0 -Lp`Pf@P^ 00pp `PPU S`P*g8F`PU0 @ @7"P p-`L@PT 3P 0 0gp@T00@T $p@pP7"T -LD`p@P@T P PpP 0-LP@Pt40 p-PL@`T P Q 0!00C0! 000p@T00pP -L`M?@180 <0 RL qPP ` 0  003S*@P T`1p1:#@@Jq`V@*a0X@3#:ZPP@ Ya@P `.`  `00 (q0!, 00@! @qL -L `xMM?@ 1 0 <0 R pPP 00  0  003S*@P T@ 5P 5:#@@p@ RpPPp MpW<0HdSp0K` 0 y:]eP p d `P p @? 0  003S  @X T pv@0! G00!p |0Pd@ T: 0SW R 0 S:1SXK R $0Q:01 S <, R 00R: 00R.0 R 00R: 00R 4 8R R 00R: 00Q*0a l~ 0  XxGQ D R 0R: 00RhSQP R L P: 00P R:RTL0SN[QX R T P: 00P R:Rp:T0S\4_Q\0S @, X8dDl0e @o`P @ 0  003S*@P T` 5:#@@oTp0SP  v=?0 0@h  003S @T T p_ ^(@$P @* RO ,1,0SS 0SSS; P:0P * P(000(000 P:UoRo00, 0R@00 pP Wpp0  0!00C0!0p0@00{L8Xs%o` 2o R 0_@d -LP 0A  0!000!000 -LM?@1P80 <0 R UC n`P P 0  003S*@P TP1p1:#@@nPU[P@PnRn(0PSK0GSD0S P0S>0006p0@`T$ (0PS00S0GSD0S P0S  (0S00 00`H0@TV@, T 0 00@TPL -L`p0P0U @T=?0 0  003S P`dpP|0U  P  PD`pU 0PpU P L -L!PUM,0 U 0A  ,P Ip0`W"*0p $00 0 r@ T"=?0 0  003S  P d00p 000 0`V:,}P  p0`V *0A$00` @?0 pV:,aP  -Lp PMK 0A   JP ?(P`,` U 0@ T!=?0 0  003S !Pp d`,0P0U,0  ,P  P`U 00P`U P  -L M, 00 A  0P W,  `Q U<=?040 0  003S  e pY'*@ T)4 0  003S P00P0P0S $p dP,`0Y: 0P , 0Y *`{,0 PY:0P  0-LP@ PM+ R"$ 0 GR 0  D0S0C=?0 0  003S $K b\ PdP 0 -L`p@PQ. klPP  =?0 0  003S*@P T11:#@@lP@G@PPl>l 0!000!Y )T/\/t////@" @ 0I@ 0@ 0@ 0\@@ 0!00C0! -LP@Mla@T 0 @TUM hK@.@TF 0A@ `>cK; #0h@ d0KhKA@}?p 0  003S)`K  \(0@PS Z `*0dKh0 < !@ 0  003S0)0K  \ @P0`Z:@TL 0-@0L@P@T 0&P0L 0-L@0P 00S 0000$\*0( (R 0 R0U0 (0S0 000 \:0!@ 0T00   0S00![0L -LPh2h@Mj Z @V: P`d(@dTV:  7P`dhpK @V: P`d0 0GSD0S @Vx: P`d0 Vm PL `F*  V` P `F0VU P `F@ VJ P`FVA P`F(X/ V6 P`F0pt@V): P`dX V 400`F0L|V 400`F0V 00`F0 ZP f -L808 P 0 @0 PL p-`P0@0LSp -L -L`@ 0b0 0GSD0S tS0 `P  0SG* 8="  $P  0S*   00 0 0+P  0S"* @ P  0S* x tP  0S* L  00 0 (pW9 $P  0S*   00 0 0`P  0S*  00 0 pW 0 R05702 05 0Q05] 3 702 05 0Q05 3 702 05 0-L@|^P0 0 X00S  RQ 00@TPS ^0L p-`P0@ 00 LS :0PUP^p0S 00p -LQ p^ -M0LA 00S0 1@ 0 K0 C p-L@]?PTb !0!00C0!<0S \0000!@!00C0 R00 00H L0L0L H0H0 R00 R 00 0` 0``00! 0!  1 0 1!$$1 0$1!((1P  0(10 0|` 0!l20Cl2!SRp Up! -LH DH |0SH R Qڀ0S  -Lhd\ 0S0S |0S 0S 0R H\ -L -L@ 0!00C0!S4` 0p0QpU  !0 !!\ ń`P 0bV0V>P   Q  0u]! -(#LR 0(3 -L@ 0!00C0!S2 ]P 0!(00C(0!SPNP 0!(00C(0!SAP = P 0!(00C(0!S0 0(] ! -$CLT= 0$3 0!00C0!S2 P 0!(00C(0!S P 0!(00C(0!SP P 0!(00C(0!S 0\ ! -L=?0, , 0!000! -=?0P@L,P TP  0!00C0!S 0-LP,@eT 0!000!P0T000,0%0 -LBb]H@?PT 0S h3 l 0h3d2p0P0  BcH@T@0S 0RP !H R 0S0SP  O K-? l0S dh3Qh3S 1 00<0Q0l000!M?@l00w0SA ]?P@000ppp00S0@0@0Sl^`0V$ 0R 00!VP | H R 0S0SQ   00!0S00!  -Lp2m 0?`S |0SS000,@T 0!000!P0T000,0E(P 0(3$CT= 0$3 0!00C0!S2 P 0!(00C(0!SP 0!(00C(0!SP P 0!(00C(0!S~<1v[,SU 0,3 0!00C0!S@[0S E0S $Q 0!00C0!0$ 000d0S Q 0!00C0!d0 000hp00Y 8"(Lp ! -L@P . -L ' -LH@K` p M?>2D 8K =?0 @T X|0S =?0 0 x 0hRl00S0VS S  0S" Szh0Sw 0r W  `&PP0Z0U0S h fPUhP|Ps? 1 01 1 01W  9&P00$P0Z0U0S h>PUM 0|PR+ 00!H L0L0L H0H0 R00 R 0000 H L0L0L0H@L@ 000S0@0@00!@T_= ?0BQTP P =?00\ESA P=?0   -L40Q', 0(\Y -00L"11@2` Q 0-LPP P P ?0@S `0 0cP =?0@=?0@00<" p-L P@QM (`KPP=?0 0  003S l\ Pp -L@  R r0!000@<" -LP@`qpn@V P-U U $U !]?P`T@p th0A0ppT@@=?0@p T@@=?0@p<" p-L`PQ M @=?0 0  003S(K @(K]T !(KV(K8@KU  U00P0S=?0 0  003S \ p 0-LPT@K@@M-00!\1 X1X€0 2"P0 L 08!2 H0 T  B"K00!G.lD04 '*Q%: R 0Q:R0 0 D0@ 0 D0 @ <08 0 <0 8 400 0 40 0 (0$ 0 (0 $ @=?0 0  003STK o\ <"Q;"!0 -L@KMT0 dP 0 -L-? 140<0Q $P00!H0H HH8 4@ 00 00! <";"%%% p-LP@PM `K=?0 0  003S \ U =?0 0  003S \ 7"p 0--? 1L40<0\0 Q h h000S P00 00!80 2c! 00!P j07"<" p-LP`PM @=?0 0  003S K @TU @=?0 0  003S(K x@T V KU(Kp p-@0LS -? 140<0Qp h3 RP pH3P  83 40S  ,0#StP U -L(@0M=?0 0  003S8K i@8KT(8K$P  0-L@=?041PSDC 1P@00S 0 -LP`pM @V8 6P 200S, 0Q s$0S P0S  0 PP`F@ 0 ,0S -L`V00Pp@MZPV\  000 00 PFD\A 0S> VY @PT T@!=?0 0  003S  P P  0ZS =?0 @ 0T@!  003S  @T T  p-L` PQ@Pp `U D0  0(0 0 0po" -@ 0 00000LIRo" -L@0S9 Q3 0S0S*B`p0QSY 0`Y(`V  P V  `P 4@0S808 0  `0  ,0SD p-L@0`S PU 0  PD 00S@0S 0,0Spd -LpMP4`Q 4@T 0SUvP $0K $` 00P$ -L M00  -L M00  -LH -L`pW PU \ 0 00  P00 00P0 @0 T *0fPH QQ @ T:T@E"P=?0 0  003S _PT U*0 P 0@*N 0 P@1@!T@!T =?0 0  003S VP0T* FP @ 0@  -LP`p@QM ( 0l@ &, 0_@ & -L`(M0L0 D H \ P Q 0H 00D  ^00 00 PD Rn PE`U P 30 U 0U@1@#P0 =?0 0  003S<K T <K,X-K\0PK5K K? 8,8#805K0 ` K@0`0K0 `0[0`0K0 `0[0`0K0 `0[0`0K,PP ,0 R  0C PR,^%|KyK[ uM?@1Ko1Kk1KgK@` P0 0 3 0 3?m?`@ A01 0 A P 3 0U 0<"Q<" 0 3? -@0@LT 0!000!Kv;" 0-L0P M%P @Q FP =P 7Q4@ =?0|0Q A4!;0 #;! R |0SR@0!-? T10 10 1 0 =?0T 0  003S K \ 0 -LD@@H\ 0S010101H\ -LHD =?0\ |0S 010101H\ -L0p M⣿PV<"Q ſP ╿PPGU -? 1 0<0P| @m?` 0  003S(K  t@ T%@ 0  003S,K a@T@ 0  003S0pK N@ѼT ?@U|0U E4%; #;! R |0SR@(?=?0!,0  10 00(0 @Uu  T e  070!1,01001 -0L= ?0RQ0S -|0LS ?Q{ ,0Sx 0!41R81R01R @D1\ H1\!1 @1\ 170 <0 RW x0 ,0S |0 -? 170<0PC 0@ ?!00'0 <000R00000!0S H L0L0L H0H0 R00 R 00` H L0L0L0HL 000S0000!  0-LP@U@0Ƕ00hP00!H L0L0L H0H0 R00 R00 0000T H L0L0L0H@L@0PP0S0@0@00!<0 -L M,`4 V 0!000! 8 t Z%Z:eY p1p!0 P0R   , A00P c2b217c! b0B!66  *, 00 c2b217c! bB!, R $0S(0S u0  a2a217caA,3)P" , 00 c2b217c! bB! g,SY M?@ 0,K0K 000*Px8n40c -LpP`M$=?0 0  003S ጻP pP`dV ᨀK 00V010#-@PZ  -LPp`SM,ڀV@1@#=?0 0  003SK 8T KṺX   K000PZPp``V  -L?l 000` 000T 000H 000PZ,!000P,<"0>"4@"8B""8D",<" -L@0! RP 00 0000 0\0c 0S| 0 S21l 5:S51` 5:s8P ~?0S@ 0< !=10  !"8D",<" -L0! 0R0S 00 000000 ! -0LS t% -0LS |% -t2t 0L0S0X2 @ DŸ0S8hК$200- , 0)1? B8c02c2cQ0A000!2? B8c02c2cQ 000\10000` R810bD100Q}Q}000a$!1 00100Q}Q}0a0 10 00xS0  2>00$ <00 0Z0 a B l 000\Q a2B10c02A100%%%%<"E.D;"%;"%7" -L Q 00Q0cQ00 0b00 0p0X 0 p00`C;+0c 0P@;+@0 0;"$<"p%;";"<"l% -L@@DT,,0 R=9B =C0 <"?B p-LP1Cυ`00 ‚01BT11P x1T  q@T @T @g@@T @T @\@pQ -LPp`% 0M?@|0S 00CS 0(0 pS00$0SXX!000H!0004 0S0S 000@!D!H! 8" -L< 8H R 0S 0  H R -LM00!dd0 @S 00H00!8#0dP}?0 2b1b!b111 503b"b2005 03b1! % 00!"0 0bS00K@ሢ RIp`l@010Q0 P08"0P000,20\0c 0S "0 S21!5:S51!5:s8!~?0S 0! =10  Q00?0000S`pWPa0@K@",<"H =10 Q $0 0 cRA00!,<"@L" -t0  @0LP㣷P@ < 0SP$喷P<"D8"@8"t%X8"T8" -L0K, K M 0 0 0 B$0 P -L=?0 -=?00L| -L=?00 -L=?04 -L=?0@ -L=?0D -L=?0| -L@p$`KM]?P 0  003S  (@᫶T [p0P$@TRP0P (0S 80C`B0T ɚ;MbG& 0?B c11 T0S  M?@00P W t 0 003S111@"c#b<#$K130$  \ k_kQ -LP 0!00C0!S R 0 'CPL" -LP%4%0 1` R 0 S 0!000!@Q&poBP 0P0@@ R 0 S 0!000!@P B R 00@`TL"PL" -L-? 0!000!0!000!0!00C0!  -Lπ H30 00 ! 8#8SA(A$A"A!A -L@0 000T 80@B( 0!00C0!TTP"XP" -L00  -L@400!Q 043 0!00C0!S$0aB 0000!! -L43@0S000 00 0P -LpG ]?PO0<0?`8H3 00RV;0 0s 0 /0@CT$ -L0!=?0`#\X ! -L0!-? 0X3\3?8H3 0000! -LPpH21 32K `@T 0S `@T "!010000 000S0`0S ~|0Ap 0!00C0!X@T 0S @T0 00TP"XP" p-L0`M?@PP XÔ\  E`21 32 \ 0P0p   PP-? ?8ÒH3 0000p p-L`P F2  12 @02 00S0S0@@0@A8 0!00C0!@QpTP"XP" -L  -LQ Q" 0SP=?0 0R ?418S 0!S 01S S 1 0<0P -LQ0@1 1SP0@ S 888 -L0 @21 32 4P -L@ @ P$PP0S50h0nkhea -L`@DQD10p\01 ?^0 0!000! 0T T =?0`@ @|  0100` 0  0S  TVT 0S F   0 1 0XP"%TP" p-LP@ -`P E21 32 00 p -L`@@TpP$`P `T 43S 0!B(PT D21 32 `! p-LP`@0!4#R!pE 1 0S00 0 <0L#8H3 0 000! p -LPp`R\@XH@P T 0S | 0R UPPH@ T -LPp`RX@TH@P T 0S 0S fUPPH@ T -LpR=?0 rPAH@` T | R =?0T 0R :`pPH@ TVR bB4";#;Q |0S Q |0S @4 ;#;! R |0SR ! -L0R  -L $ -L0R I -L0R a 0-L@4 ;@#;PRP\ |0S \ |0S N4.;#;! R |0SR 0! 0-LP@ 30@CT0 p-L`@M` h00 |00 PS |  0   U(NTA P Kzp -L -LSpMtQR PM?@ 0  003S,`K PxU],07<,0 00!τ40KW W W 400 0 400 0 83<#0 K/? 8H3 0 00000!X"ZZ 00!=?0?4 K00! =?0 0  003S4K ᵱ\ 0-L0@TM00!=?0PK8#<HLÓ     ! 0  003S ኱\ 000 -L -LSM  :@m?` 0  003S㰐K  E@ ȰT07< X 0 0  P 0  003S@K (P᫰U | 1R0Ss00!K  PR1X0  @Kl1\! &T1?Bc 11!\0S  0S1 M?@Ώί 8_<3 08<3 H3 0 00000! 00!  8H3 0 00000!^ @\ KDP @ɚ;Gk_kP @@ -L M=?0 |000 0  K|  -L@PM?N$.+"+,0@ 0 | 00C0 \  !\ |0S\ K  p-L@P`M=?0 0  003SK  Q@KԯT (0S$E4%;T#;` Q |0S Q |0S @4 ;#;!! R |0SR Kp -L@0D?SpW T T]?P^114C`00W+ 00 07< 00S S0DTST00!2P /? 8H3 0 00000! -LpQ M =?0T#P3R(0  0cS0#030$0 P+ @? 0  003S 004 `R00PR,00S' @P3T#0cS # 3R@DU` @ ^:PcTQ @ =?0 0  003S(K ៯\@ -L -L`pQMB PM?@ 0  003S$K ]PUG$07<$0 00!8#V( V V $00$00$083/? 8H3 0 00000!XWW =?083(0 =?0 0  003S(K 4\ -LPSp@`(M6T *P=?0 0  003S0K P0KxU !T0KD@KV  P0V0U0S =?0 0  003S \  0-LB4";@#;P\ |0S \ |0S N4.;#;! R |0SR 0! -L<ÐL#8H3 0 000 -0LS 0\0 R 0\00 -0LS R00 0S p-L@`PT   @Tp -L\P" -L\P" -L% -L|\% Q Q Q R=?0P \R=?0 PR=?00!0P -L@pW`t@PȠHPT@ U+  P" -? 041Q 01Q 150<0Q` v$0`T 150<0Q ` $@HP U -LP`Vp@@<  P $00cSPH@T -LM?!@%0 <0Ro x1PZp!p1QQ d1QR\1\+ \ H1\ H<1\* 01\ @$1\ <  WjD 00@0= GB >B 0  003SK P NK L00KP#6i(!CgE#òͫ#\P"%$ -L \P" -000LS 0 %%% 0-Lp-? @ADQ ^ \ 1@00<0^ 0q T D1S H1S 1@00<0\ \ =?0, |00|0pqQ =?0H=?0LD@0 -L?1D@00 <0 R \ , |00|0=?0LHD@@1P H1P\ , |00|0LD 0-LP@0P 0T =?0, |00|0=?00Q0 -L`v-? 0q4Q8@ W U 100<0Qx @W 41S 81S 100<0Q P TP T =?0, |00|0-? v4A0011U-? 41SQU -? 41S11( -L@-? 814Q0a p00<0Q T UXP 01T TU =?0, |00|00-0? 4A0011U-? 41SQU -? 41S11( -L@P?10q4a800 <0 R&p 01P 41P 81P t -? 01T 41T 81Tu -? 01U 41U 81Up -? 01P 4TP t ?41T , |00|04A-? 41u<18Q00!VW X 01S 41S 81S >0011V-? 41SaV -? 41S11( -L@=?00\P4WP8R -L?1@00 <0 R&p @1P D1P H1P q -? @1Q D1Q H1Q~ -? @1^ D1^ H1^q ?D1Q , |00|0D-? D1pL1@~H -L@=?0@PDPH -L-? 01<P 41P 81P P 100<0Q P , |00|0=?0<`00\-? <1S101\ ?<1S1!0 ! ( -L-? @1LP D1P H1P P 1@00<0\ P , |00|0=?0L -LPM =?0@ 0 31R    0  K h@T 0<" 0-L@P=?0|QQ0@4 ; #;@\ |0S\+ 0?S 0S  0@Rx0 @D\0@SQ LHPHP 0S 0R HP@0! -LP=?0@4 ;4 #;! R |0SR ! -L=?0 -LP=?0@4 ;4 #;! R |0SR ! -Ld`H Q =?0 |0R H Q=?0 | B\"  -LP?PA T 0  003SU ឩ\  p-L]?P1`@00 <0 Rp VpA 0  003SU Z@T ܨTPap p -=?0PLQ U/0S  Q -L=?0L1 P  -L=?0D1 P  -@XL⌷bϠ=?0 0  003S( 0\@ @&  -L`@MM?@1p60 <0 R$ @W! 4Pᗷ 0  003S`K P&U `KbU`K @P ۷% & p-L@PQll`0P=?0 0  003S Ϩ\@ @p&%  -L`@MM?@1p60 <0 R$ @W! 4P6 0  003S`K ၩP&U `KU`K @ᱦP z) & -L R=?0z 0  003S u\  -L P@M-? 1z?K0S10 0S10 0  003S N\  -Lp WMPM?@ 0  003S$`K PᗧU $$ R1z?0RQ140 <0 R W$0S0S 0K   p-LP`K@H`HMdt T(1!@0 ?< 8 2c`0 11A2a 21D 1$!(@0 ?< 8 2c`0 11A2a!2Q1@ !10@0 1$!(0 <0 ?2c`0 11Aa8 1 2\ ?2cX0 11!B2b!!"T H=?0 0  003S`K ᘧ\ Qp -L 0S ? } -L++=?0$3! ! -L @ PA <h@R3=?0p 0=?0p_)-? x0$ ,0S! |0R=?0, |0R00|0=?0.0 R ? 0R000  -0Mm?`00d2L, 0 4 $#8 ,#0!000!,S,# 0!00C0!S@ኵ380Y 0!(00(0!8  X 0S 0!000!80Z 0!(00(0!8 pW 0S 0!000!8 $S0 @Y0 0!(00(0!X 0S 0!000! P T 0!(00C(0!SZ@ 0!(00(0!W 0S_ 0!000!pP ֮T 0!(00C(0!SP @0 00T 0!(00C(0!SᲮY 0!(00C(0!S ᣮZ 0!(00C(0!S 00!_@@8C.? 8H3 0 00000!(#0T 01S Y(#0@Tx0<1810141L1H1@1D1P1 ! 0 3 0 3?,04  ~p `0 P% %0` % p-L0K`0X X@XXM0 P0 ` 0@ ( $ ,0 PP (0(0 '& %p - M?$3 0L( S(jz0 А/ 2R2 0!000!0Sژ0  Q ʀN 0!00C0! W(T }P(@ h; 0!00C0!D!$'`P"(00!0Ko0_83008#H3 00000!!0 0!00C0!00!0 K 8H3 0 00000!\  (0lX -L=?0$3 0@S    -L@  PM@ -LP,0K`@\M<0 80 D0KDP @P 4pKlKlp h` d `@ \P XK@K0 0&XKDlPKp t 000S 8P  BGH -L$0!^ !AK(( -L$0! !я(( - @L0S ddP" -L0@P 0-0? R@@hP" p-L@\`tPDP  0!0@P0@!` Bp<(D( -LP8K  $Mm?`㠣4` 0  ぢ|1|!@@`00!Ώ883 P8H3 0 00000!LK 8@0 @0KL@ H P@ >0S00S0 W0S j 0S !0\P00! 0 0 00000!dP"hP"D(<(P( -L<@K M)m?`p,PK8` 8@00 MѹpWZ P(lP" -L,@@ -L!(0"(QR V -L!(0"(QR  V -L!(0"(QR V -L 0!PQY -L  -L 0!PQ -L ? -L !( 0"(PQR  0-LM?@01PS`0%!>31SP41S<0%!M?31IP81S0%!N?31?0% -L !( 0"(PQR  0-LM?@@1PS`0%!=31PD1S<0%!Q?31PH1S0%!R?31 0% -L  -L P 0-LPP@M?PA T\TK !U?0\0=?0 0  003STK Т\ 0 p-L@M]?P1`@00 <0 R% V"@ 0  003SXK ዣ@T XK T P X0K U?!P=?0Pap - ?01LS0%!)>% - ?41LS0%!)M?% - ?@1LS0%!)=% - ?D1LS0%!)Q?% -L=?0(C0 000^5 -Lp$`PF.@P $㠡p`Ph!^ !AKD 00 0! !\(p( -L@P p!^ !AȞK 0 0000! !Ϟ.\( -LP  0 0000. -L`P tp!^ !AKPP@T D0@S! !љ\(p( p-L@0P 0 SQQ`V 0S  \P` P0S   p 8" 0- @0*&#fr`PPJ :#:@ 000  0 * , P P^0000IPᎭUK(`FvP# 0 R $0S(0S 9T 0  a2a217caA↰`FvP" -`0LCFz 0'zQPPU 00@ :EPp@U0T p-L@0`V0QU 0 50`V0 00p -L M, 0 4 X',0A00P0`UpW )P PEu 6P PEu `0PU000 X, 00S 0400S40 Y  -LpWQ0 `000@VP @0`VpW -L M ?@ ,0@4 * <0 0, 8 0 @P0<Pp0  ๯4 80R@%0 @\X d8fD 0j0S6#H0 <D P @;tH v0fY#1!@0P@c2d217cA@d,0DAF @LIU N00z00S W:6#jjDHV0#03VPD @T 6# 0 80 ZZ0 :@<P0P48ȯ!P" -Lp,M ?D ,@8p  g@ 'ʠ00 < , 4 DP0@P0 )8 <0R@%4 @\b DFH ,<0g0S6#dP0 L @H oP @AdfP L0dY# 0#V10T 10U*0000@ 0 ᲯT0S 00,Pj00S V:6#JJHPT0#03TPH @T 6#zz4< WW4 :D@P0^8<.P"P" -Lp$ßM@, $ ^*1 0a ᛜP%6@YT M?@ P0R  ℮ PG P0R   a 0!000!(i2PP 20V "0  b2b217c! bB! Л0  b2b217c! bB!0  b2b217c! bB!!0@S@0@,d00d0$!0  b2b217c! bB!/M?@ P0R     b2b217c! b0B!6᠀î P0R {  ݩ*P^3[3  ᲿP"P"!P"8L3 0-L@P4  0CR: #6 bR* b&(@T0 -LDp0XD0W$P(0S 00@#&ZP (P   ( ?1s  0XW 0X0WD00S ,0S   p-LPKM;@`20@00 T0I4Pp -LpP`4@P 54@P0SY 0S  2G50 0S5d0 0d00 S b2b217c! b0B!V V50PP h 0  b2b217c! bB! ṭ  ۨ P"Q"P"P" -LS`pl1l0 c2l217cl0L 6 @@ ,0PPC A0  b2b217c! bB! 90S (2d00d00  b2b217c! bB!ⷬ  b2b217c! b0B!6@:)4 T v!P"P" -L`pM0Q 0S 0w @P tkZ0 0-tY0PP1\P0  b2b217c! bB!0  b2b217c! bB!"1(@ 0S'0@d00d0 0  b2b217c! bB!+`0Z  b2b217c! b0B!F0@ɬr1P"P"   -LP@$*`M? p! R7  <P1 \ 0O& 0pyW  0 P P0R7 ᙧ -L00 -L`pQ(P@T 0000C0T0a%0P P 0S 00000~D0@W!.(5? !!  p-L`PMM?@,0V 0#0%0U00. 0,&F"Fd 00 00Pp -\0L :1S ?0;1 %/ 6  0 P" 0-0L0PSl0@0d0d @0 @T0 0!@D0!0"F"c11#FT00P"P"P"7* n" -L -L -L]?P,@ ᅧ<0X/:0 Lp0`V% X aP !r@00cS0PZ 0U00S Pf%P PL L@尧 p-LP@`P N0S@0S P0SU000E00p -L@R 0 0 @Q@0A 0 000 0尥80S 0   0!(10C(1!0$(0S(0 (0,0@, p-L@Q`@B2 0S,80 S0 S  R" PU/ 0Q,80 S0 S  R" 00 0 0*0S@0h 0C0$ @T 80S0 SP 0Qpp! -LP0MM?@8 @ `, P<  0S 0SS 0,0L80S G8>0>080 0Cs_8.pD Y*<3 0R 1 8 0 `. :#:S&0<,p00p  l08("6S&Z0 0S S& 0 1  0 1 10,0@ 3?0:: SP 1ሀ(01  ꈀ0S S ꈀ , K00K<4KH L0 P pP 8 0R* < eP =?0<8h 02&R 0S D%P Z 4 R <,8 0Pt< #pP < 8Z! 000!000480@0<0  @\~  x@Px@ 8 0!000! 0@PR B@P`0Y <H L0P CP  0R *Z 0(!( 嬺00,@0P4`< 0`J<000@P 0 0!(10(1! <8h0,&0h0 l0 <0l0Jd@P 0 0!(10(1! 8PXO0  C<#! 0-LPM@ 1eQ+:#:S;P \ D0S  0@D-@UT >0N@=?0, 1eS:P  0S A=?0,1eS:P  0S@ 0 -LP ^ 0S0S R  R B0S 0S^ p-L@`P8 P\ L0S0S  P\ L0S0 SP $0S   0SR00 0B0 0Sp0S 00p00p -Ln`@PpW 4  W% ?0"0lS0l# Ph00"0R:  l0("0R* 040 0n40h00h00  l00l00S0  0 -L@#hpnh`  l00nl0 V0Q00S 0S 8P 'N,1!0Q`j8V40 f"640`.0P000000p0X, K@P 0PS*S*0SL0 0R<0 P0  {,0 S  T (! 00 ⵢ@T 0S:@Y00T   0WP!P1R ! e4  UR 8Z 0 0!(10C(1!8 R 0   0!(10(1!( R,0,0, (00u04 0C0400 Z0  0 0!(10(1!@Y00S $  ,0 ! -L`=?0,@PpҢ 8@, -LYMM?@,u PU U*np0  l0("6S e , K00K4KXpP 0S*  P Qh00"6S01 0R)< P 4 p0Rw080 , 8 0P#0pP  008 0!0004080@0 ,@0P4` 0`1000h08 <  0h0 l0  0l0@ (!( p-L`M?@,0P6i,0@␢p p-L 00P`U @0000 0@彠 P0Up -LPm?`P0U6@T& 0p0C0g8 R 0   0!(10(1!( R,0,0, (00S 0 @T0S00P0U㪥@0000d0h0l0` 5T 00 PS 0S 8P K0@U ! 0-LP K0K@M KXP  0R0305 0 o0000 -L$ K(0KpM,K:P  0R :$@(P,` 0`M000 - L$R 0$0(0S00! p-@P0(0LS  0` 0```00CS0 娡0$ S$ 0$`!p -0L00 -L@−PP  0 00@000@ P $00S ?  7L -`PLU! @0PC2VpP(0S M[P 0S  !) -000LS KR 0-P(0LS P  !@)0 -LP0M,0 @T ` V*0S 0 S 0!000!  0P 00000P@0P0PP0P,0 [pWS 0 SPg 0 Siij|a0 \ b2b217c! b0B!6  : R $0S(0S N0  b2b217c! bB! 㜣 0  b2b217c! bB!⤣(0S L00UF0 (-? 0Sh 00vdP"@Tc, -Lp dP` P`%&:`M  PK A@ <@ 7@ -LP@Tp `9PFp( 0R S S 0 00000P@0P 0!000!R  0 00P@0P 0!000! QpݎڎW@ 0 00000PP 0!000!0 bH(-? 0S 00Ӧ 0-LP~@{@x@0 -L`pPU @(0PS 0 S* S: 0!000!(0S pYP( -Lp`P0@ 0@ 0@ LP0@ 0@ 0h 0-P@0L3 0 -LpP0 S5 @ 0 00@000@0! 0!000!`#P0  W00P0Sp~'0S -L`Pp0 S2 @ 0 00000@000@0 0!000!0 㾍V00P0S`>'0S -LpP0S @ 0` 0``0@(@0 0!000!/0p'0S -L@000 0!000!0 L00@@ 012 0C P"P" -LP`@6 p002#30C =:74 1 . 0!000! 0 00PDP`hP"P" -LPp``V 0S 0 SV)@  ᣎ 0!000!  0 00PPp$X -Lp 0 0!` B1310 1@@T 0S 0ST0$PP   0pP ,& 0@!&P"P" -LP0p0`C1SPP0@DS U:P" -2`2c2c1D 1c 000 LR  VP" -L@,`K2d2c2c11cM 8] ?P32 0q 㩍(P y000 0S 0S 0S K000ჩP" 0-L @2b2c2c1\1c (02, QP0 R  0P" -L@,`K2d2c2c11cM 8] ?P32 0q I(P +000 0S 0S 0S P"P" -L@ҍP  -L\ 0S 0S\ 0!000!  -Lp0!02!1\0C ! R 0S 0 S@R ▍P@P"P" -L`Pp@@T 0S 0ST 0!000!sP 0S 0S ,$ - L -Lp!01M02#30C `A 0,0 PP@?#P:  PP*P@    Ὄ 0!000!, 0 00PPp>XP"P" t$ -LPp0!02,<0C  @P `P0S 0S N$`0"@P  0P 9$P"P" -LpP 8 \!#<!RL10D 0`!:   40 S\*800S* `V,5Z0 804 0008 W ,PV \ 40S:`FV2Z84 p@@p W*T*PW 0,000408  Q0 408 ,,#( -L0@# 2 -`ML, 0 8 40 8 ##<!R30,0!,: z0 'zY800S*< 04,8 < Y 000 S,0  0 000, 0#60R,05< R 2, 0R,05,0 S, D2 gD 131! B0 1 @ P 0 S 0 SPP 0!000!0D <8 0(0S  R $0S(0S Y!0 a2a217caA⦝W (0SD0D04  @p'z#D'zT0 0S<8 00@T@"l0 700P0<8 00 000 0"YX0N!P= @ #((P"P"P" R 0 S 0 SPR^P@    Ὴ 0!000!@ 0 00A8 D0!:Y :D0 8D0:#:SD0   !J6,0@X0(0 \"8s -L$M8 4  40< 4 0  d D D0`0,0 ͊P ,KţPP< PX!@  B0O0H lj80g 0S$0S Q] 0^  0SRa PP HPU PUBP`X< Xpw08 ,0PP2 H Œ400$0, S@0 @04$ @0 P0U00P0S ,Ue8`8 ,U VP< RD(,Kc p-LP` S@1@!l2a217ca0A61 ;P@` 0 00d00 0 0 pP" -LPpRM_0=?0 0 @ 0 3R@W ,18 K8@ 4p 0P ,@ 8@,0T@@00@0W ` < Gl!^ ! AKD00R0Q  000P/@0@! ! Ѥ<变3: S 09(Z -LpM`@@SP1P!P 0 U#3@+-? @ 3 0 3?x 0 0llalL   -? @ 3 0T 0P" 0 3?Q 0 a 00 -L@`MlBPf 1a 0 @DQ\ 000SW 0S 00 0,0@ 3?0:: S0 8@@T=@@BPP8 13 0 @DS/ 0S, 00S 0 0,0@ 3?0:: S0  @@TZ Y  <08 K8@ 4 0P ,@ 8@,0T@AA|\ -L`pPRM ϊP $K0O K  0oU0 $ -Lp`RM P=?0 0  003 S,@K ៉P"U   0AV0 0K -0L0pQ 0S 0S 0xP`D0 !:XhWp! @00Wp!W wpWP" -LP@ppA`P 1 $6:#:0#&@ -`800L08 !#<Q1p0q<0S 020C32r400<0<0Q+40 P@"6T@!U" 0RUU1*8 \P`0S ^40<0\0 FFDa0<00<0#(P"< -LpM480 ` 0`#600 !, , }_`D0 !:`X:=?0 ,0R 0 1V`!!02!10C A  PP 0- 0   eH@!0  b2b217c! bB!⫙UX*0   P pB@T 0 0P0 0@T'0 P"P"P"3 0P0 0 -L`0M, 8 &:0 140 -? < P0P 00lV8%%0f4 @ &ʠ ʠTV0S6#D H0 L @0DH eRK 0P0 唎@㻙 @?0;1%%/p%::DFZ# T ! 810!Ơ\*(! 1 01X0 0@0 㗙0S ,< P0RTJX2pJ00S T:P 6#ZZLH0@ UUL  @ :6#j8j4VV8 4 :=?0,P0 R0a 8P"P" -L@0 0( (R 00S 00S 000( -LP`8p 0 W> 0;  a0#PP64 0@l!^ !A&KGP 0S ,0S  U00P0SPpU00P0SP! ! -LP@`?,:#:S/>0N@p)* '0S$ `W! ,@ `T 0U1P1 W U* 0|`P  `0t`PP @ ,⽔ -LpP0`@P  D 0Vp90 V98080<0Q 0!000!00S 0S 04 0c#&4 p! -L`P0pl@P  D W`04 0c#&4  W98080<0Q 0!000!00S 0S l`Oj! -LP@AM0,0 &pP S  `P ID@ p l04 0c#&04 <0<08Q 0!000!00S 0S 000<004 0c#&4 0Y90 Y9!80,, 0-L@P^ 00Q0R 0\90 \9800<0 0R * 0iP0( -Lp M8 , P4  40000SN0?,0 D0P`0 40@#P0c.vZ 0c0c#z?0 0 gd000S+0\ 72r020C32 WW1*4 P, 0r P" WW1*4xpP, 0S ,< -0LJ a -LS (r(r(r0r8rI{ -LP@`?,˒:#: S)>0N@pW": ` ,@ `T 0U1P1 W U* 0`P  ` 0`PP @ , -L80x 0001!2!T0C ! R 0 S 0SR 0P"P" -L@ M8 P, R? 0,0 04 c.T0c0c#FP- , 'ph0W,0 "`P W@1J#U PU=?0 0  003S  ᤃ\zGjW , -LP@`M?, ,ؑ:#: S->0N@pW&: `$ , @ `T 0UP1,` 5 W U* 0`P ,`  0w`P @0e#P, -Lp`P1!02!1<0C Q V@PV0`P @ @ 0P`  PP{@V ut 0PUd01`   PPS@P"P" -L`0pU?TX0T03: S 0 D0003: Sq  0SR oU 0dR0d0 0Sr0(U tS4d8<0Q03: S#  R0S0SU0T 20 Q )0P&0"YP H RD0S 0SUD0T0H QD D0P00d0 -L8M0 D P @ H0 0 KL L0HP p8K< 000FP00S 3#0S\ -? 10<0P3 03ᦐ@0 3: S `30P0T0嗐808K` *j#00`Y!D0)0K)0[ 00C0)0K)0[ 2L0<@K!2!010C !T LT gPP0SL0P  LPT0PUn 0X 000(Ÿ A \ @nnŽl nNƌL\0@a Ps D ᄂ @R $0S(0SX 0x a2a217caAlL0@\0 T>X X 00P@`D@0hP@ 00 D 0OXX00SM80K<H@P X@P0 0,0 1 㷒P\ <"P"P"P"`D QD0PN -L@4KM8@ , 0, K00 0 `0PPS,0SP 03#0S\ -? 10<0P3 03u00P0T0n0K ,0pPD0 K P@U D0T3: S 0N0 W0  .8 8W<" p-LP@l`0!^ !A`}K I@P!<P@! !e}p -ML,0 0R pN=?0 0  003S E0( Pᾎl@!^ !A$}K ,0 @`! !-}v!  ,0`l@!^ !A|K ,0 `! !} -L3#0S\ -? 100<0Q3 03ណ p-L`0 M0 0P/@0p -LM=?0<0 ,8 *:, 0 140 <P0\|0  ȑ8, Q0#0%, 0j4@ TVY#@ eR)  F@m ?0;1%%/`DFX#p ` 0 Z`J00ST:6#ZZ@0U U0@0 :6# 4,ZZ4 :<, P0R8 -L`M, \`' 0,T#Q0 100 0Y-@pT" 0S80 S0 S  R 80SP 0 0E0S@2 00C00`P`Q  0R80 S0 S  R 80S0P 2 @Pp D 9}80<00 Q  0!000!00S 0S 04 0c#&4 =?0,P0Y8(1 @P8 D },080 0<00Q,40 b"640 0!000!00S 0S =?0,,  P@XD@r P PPk pP P F(!D |D |,0004 0c#&04 <0<08Q 0!000!00S 0S 00P0 #l*iX g pa ,K0pZ?, pⵌ,0K00 , PL 0SI  U 0S p?00.2`@T 00 P`}pP-V U) ,0 R$80 S0SP 80S00,` 0@ 0Ջ0S`007 ,0 00C0,⾌! -L`M,0 S 0Y40Z,00P 1y @Pd D {,0800Q<0 0!000!00S 0S 04 0c#&4 =?0,00Z2 1G @P2 D {,0 800Q<040 b"640 0!000!00S 0S Q=?0,2MPS@@ pP PK P P A!D ]{D Y{04 0c#&4 ,000<0<08Q 0!000!00S 0S 00P0`V39 =?0,vP 0S   0U 0SW0@:T*  0 PP  -L`PM?@, p*d (`000, Pl0`%& R800R p,rP" p-LPm?`,0@ 000P@@~,0@Vp 0-L?1P90 <0 R0 ,0 *p ,0@ @T 0: 0sP 0 p-L`M?@,0PU 0 ,0("h `"Q(00Q`, pP" -M?@,L⡊,0@ -L @`p& 1P R  %x ៎ ?0;1&%/QY4 P ':Q  (Pp 1@ R  %Ry ?0;1&%/QppW @`PV lT@Pf , -LP@pm?`P0W0  U JD P TP0W P0W D0 g kJT:  -L@PM0  :#:S0 >0. 000 040 % :#:S X1hZ 0Z0X0Sz Z0 Su Y0 0 So=?0 , '@TXe0^:=?0, h@0TPW @00#Z00SO @?8 , `PF 0 SC00 0iR> X9  @8008, 0ll (6S, @80 ,0pbh00"6S" 0S 'P 000i\&00# Y00S \ 1R00iS:'Ơ8,0h h 0  00, l0 0l0> @ @ 4\  0840@:#:S < P, Ke@PT ,Q; 0 S880< S0SP- 80S*(00,< 0T,0 RN80 S0SPD 00,p 0 0W0Sp04"0C01 0R-80 S0SQ" 80S<@ J P,  0 S80<S0S\ 80S00, < <0@S@1P< Q @ 800, aPPB0Tz$ <D *x<00 8 S n V0!8@0 080S0#80%40@ D0 @ 0D0!,( Pg 0 <l`P 0`1700@000@ 0V: ( 0r1#6T! 0A`t,@pW 0W*@ H 0\2      @ 0pW:!000!@00C@00 `0 `P!( 0b`Fv1#6`  0A r,@`Fv( 0!@00C@0! 8"P" 0-L@P  ,000,0 0!\0\$  0 0000000 0010s0  0 00000!0!P0 0- W< @GpmPP  0 0 00000  J` 0 0PPwk0C30003P0 ` 0`mZ D0W8W  0 00000,*h*`* -L@P`pc@`T 0b@ -LM}?p0 =`` &30# 0(0 P (0KP!x@w(0SP( PU|0S'P P *0* -Lp`0`@]?P T:0 02?CpT000P" -L P l02b122b1#!bB :0 1R@ P* -L3p`S!J1f1fA]?P0S ͂,0S 0S mP,00}ㆂPp,@D`VZ 0-L00@PT CPTU0P" -3L S J1b1b,0S 0S@ RZ -00@LT P CTP" p-L(K MM?@k$@ H  j?  08#;0M?@00P`(PKuP U00ᐇ0S \T*<p -L0@P0M4KT0 j  000PKJ KT0K/ 4[SP0H0 "TP& `0p 0P  0cSTP⍁@TH0KA׏@!xp` V:T034K $[H0Kq3 -L@0 00 $0R00 P* -L!"&x00 A0000S00 H0 0P  +P00~P"* -L00!8 @0000!T  @TP" -L@0p@ ,3 0S 0! #00@ p!o(0S000S002  b2b217c!0 bBS000P000300DiAi?0 zH"0Q0Ġg j2b217c! bB0000>01<0@0!00f0A0f0.!0q  b2b217c! b0B!0R10*R:l1 1U 000 0c"c"!'b10c C1 S*S:1 1U 00` @⨀ 0 0000 v 0T0#0% 0,0#0101  @ !`0S<0 0S{T0@0` T00T@ p `  8"P"*P"P"P" -L@01<0 `M 0!, ^ "00c"c"!'b10c C1 S*S:X2 1T 00 0 0000 V b2b217c! bBQ  5"  02# 0p` W0 W9C0-ڤ!00c"c"!'b10c C1 S*S:d1 1T 00pGP: W 06010` 0 1# 000c"c"!'b10c C1 S*S:0 1T 00,0!00  b2b217c! b0B!0R*R:@0 1T 000@000300P"P"` VM, ! -L 0 "- -LpPŸ`P\pM?@0\` ;0` 0R ;0h ZTM T 0SF!0 0 bc02a122a1a02b122b1#!bB!AR, 0 0`0 p0C`000(0S0S0  b2b217c!0 bBS00@030\m?``P\  0@ 0@@ PEu@\0`0 8"P"P"P" -L@MP X b02b122b1#!bBa 0 %B 01R R Pz\,P0S @  @ 0!10 5CS0SaP[P}?p   0 0S   @KPEP@2   ,0K P8,0 @S$ P 0 %B01R R)P#PX* 8"0 %B01R RPP 0$50❌00S w* -L QP < 0 b2b217c! bB!P" -LP  H 0 @ b2b217c! bB!A$A hP" -0L@  0!00C0!S -LP  0!0P" -d0LQ 0 l02b122b1#!bB!R ڴ#RRP" 0-0L@^ _ž^80 @ b02b122b1#!bB * 0!0b S@\:^0P" -L`P V @U* @!܋T:SU0 @P0 ̋0pS 0!P<@0S 0Su % @HPⴋ U!`,⬋ZP"P",T` - 0LP" 0-L@2PP00 -L(0( M   {P"  p-LP0@S00mP 000p 0`131! B0p  1TP < 000p00S 000pP"P"*P" -L@000 ,0R00@e 000*P" 0-P0L00 c'P @b0 -@@0 LR3gP* -LT T0!02,<0C8 0!H( 0P0 0000*P"P"P" p-LP@ 0!02,<0C !'`PT`@P @PppT Op*P"P" -LL2 P8r0 Sڀ `$b!00Sn$0S 0R 0 0S= 0^<$0P0SLQ*0 0S^: Q'0 0S000Q000Q0A0 0R0 00 0 @@0 0C0 $00C$0Q00 0 ^ 4 `40P`(0( 1R ` 00P0Y4 P`(0( 1R| 0xPv +P"Q" -LP- 0,!0^#*1n1  00$R*0 0S h( 0(1c1QHH<@08 ܉( ׉Q"Q"+   t \  -L -L D0P @P 0Q50Q 000P" 0-LP@P 0 p-L@ P`P 4 00S (0S P P`p -L0 0S S S (0S  (0R0@* -@0L00 0R (0S0 SS `>PP 4 00pS(0S0 S SepaW  t%x* p-LP@`P LPP@U 0!000!(0S0 SS @0@ 0Sdp*P"Q" -LM, `0 4 80 V< 0#0%<0f0TVZ# U0#0% eRE  l w< ?0;1%%/pDFX#04 S#R!  0!8000!08  b2b217c!,0 bB!w4, d00d0pJ00ST:6#ZZU U:6#jj0< VV0 P": -LPp@`T   0!0w @T -L0\Q  00S S  -L"$M4 , x"1`@ < D 100 0!4000!40S T"4 0!4000!0 o뵐H Y!0  b2b217c! bB!Jv14 R8H 48 0S.4p S3#0`00L0 V 0PF1尐U8H 8 hX 0 Sp130S`LV 0!000!44p 0#R0  00D0 0S 0  T0R 00R HQ 8 Q"P"P"*tdc4=?00S y0<)P<  , 4180 00`<@PPG0S @ 4D0S k 00@ X" -LM-? 1P0<0Q DK qJ@PP!`!0P0S !l40P 1`1 P R D0R@Po\400H4 1l!0a0P00p$$,0 0a a0 p@P? Q!a((01^ !l40Q1a( 1^\4  b1317! b! T l4 b1317! b!!0, 0 00 0+Q"LQ"P"Q"0S 00 I7 D0@0 0D0 @ @@0@@@DKD -L MpP, t m 0`Yg*0^ 0S[ ?$3 PU 0!(00(0!$3 @T 0S㧄Q" Q" 0!000! ,0PQ @`04Q!0AP 0$2`R@  `P `T `4V*<Q4Q:` 904P: + 0BV0CL0 `P0XSTL`VD`㬄T9L0 ,,A 0P 00,0 ( 0L`00啄@P!`((01^ !a40P1`( 1^Q4  b1317! b! X a4 b1317! b!!`& } , @ P"Q"+Q"T\ 4X0Q    @0 D 8 000P \:BY  + p-L` @0P\* 0S000Q *0 00S  S000Q:80@T:$00 0$00 0 0pQ"Q"P"Q" p-L`0,!0 R#*0!bQ00P*@(" p0Q`00R T0  Q <Ճ` 90p  ˃Q"Q"X"p  \  p-L. @P`\: ᲃp0!l00P:Pt|Q 000SLX 08H 0S0p 0S00p 勃pQ" \ Q"  t   p-L@`|0| 101cQ\p 43< N00P * 00S  S @^pP"Q" -L Q -L 0 "!1 1@RP p-`,LP1 0 phP0 @1@@cHcP}c $0SPP01S 41SU00CQ U00CQp<" -L@PD@@pH@`T |0S P`PH@T -L@ -H| }? 00!;0 f b  p-LPP8倀4@0`, ,0RH@TVxp  -00LS ʄ0 @00c}S@l000ccS\ 00 S0 H 00c}S:@$ 0S@5 00P"<"4X"0X"8X"ΠhL 01 P< P00P0`L00CL0`ZZ H P"P"P" wP`ZZ 40SV! 82!02,<Ÿ0C !2`P 0 ZP 0 { a `,0 0S @  0C0,`00`0V98 0`V@, 0@0 s<4  [P@u\@ 0S 1813>ΠL 01P  ,@ `RK<P00P0DA0  b2b217c! bB! Z R $0S(0S #Z0 a2a217caAqlZ0 0SV -\0`00`0 @XV 00SYP"P"P"!@ - M800L00 04 c! K0P p @00 c2b217c! bB!2lP" -0L0QM/P0:P0P0:P0 -0L @3 : So0000 p-LP `PB 0@ 0m@P; =?0Sb l00+Q\P t0S% lK 6]t l0A\ P x0S lK']x l0 2\ PY lK]l00SLpK\P4y(y      P T     y  -L 0K@M00K00  IP t -L p-LPXK \M=?0j0p -LpP; P H3 @: S1O0P-=?0$T` 0!(00(0!U@ 0Sp 0!000!PP WV 0!(00C(0!Si: 0-L+0PK Mh5@PC00 0@P;-? 1@70<0Q/ ,$0Q @ 0!(00(0!\ 0S@p 0!000! P VT 0!(00C(0!Si4@/0 p-L!HP(MC`P  0,0PE 1P 8#TC:#:#A@ @K*03KdPp p-L!X 4`K DM4@P4 0,0@ 1@ 8#US:#:\K#A\ *05Kd@/p -L(M@\q/(0,0@) 1@%Q8r< , F 0 8 K3  : S;3K080 H 0S : S 3[8 ;8#8 3K8 8Kd@ -L` p8PK M4@P8 @[/ -L`p8PK Mr4@P8 @F/ -LpP`@P  p -L@ 0,0KM4P,(  -L`pP@Pg 00P1P .`PZ 0  p`(`0S P uP000tv 0`0d0 `f`P0S 0S `P0=0`0S `#f0S Q 0!00C0!0 0001 0!(10C(1!\500 0RUW 0!(00C(0!SEh01 -L`}?p(S  J 2@T** 0Td0TQd`P` 0,00000 001S dp 01`H -LP`-@tp@P  PuP0=?0(0 000T@5@$m" - LA p-L@P`U\pp0PS $0S PeRpp 0-=?0(CL0^* QU 01 0,000000^500 --? 1L30<0Q \" -0LH0SD0s -L p-L`PS S00D0 0P`V00 0V0U 0 U0V ` 0(0000X0p;" -L p-L`PS S00D0 0P`V 0 U0V ` 0(0000X0p;" -LP`p@P PEW/0PS 0S0 P ?PQ JPpT -L@pPMp`P, @DZ' @0 P 0S 0 00K(0,@S,K=?0 0  003S AK\ @@pT -L`@M5PPJ 1* 00S 0 0,0@ 3?0:: S0 @pK``V 0`S \  0 `V0 @01 T 0Sl 0!000!dDS -L`@MPPJ 1* 00S 0 0,0@ 3?0:: S0 @pJ``V 0`S \  0 `V0 @01 T 0Svl 0!000!dR. -LPhK`SpLMl `F X0S} X `zPu `A=?0 0  003S  AK@T ITY` \ * 0SPNJ Q:0l R0S 00 0,0@ 3?0:: S0 &J``V+l0S080<\   0 `l R0V`0 ` PX PH 0  P`P h0KZ l R0SV0 @l 0R1 T 0Sk 0!000!c5R -LpP`@P  R 1 80S0S  0/pY -LpP`@P  R 1 <0S 0S  0p: M-L`pM0PPK 1F 00S 0,0@ 3?0:: S pfI``V+0`S' @T$ 0S  0`P0 @01 T 0S(k 0!000!4cQ M-L`pM07PPK 1F 00S 0,0@ 3?0:: S p I``V+0`S' @T$ 0S  0`P0 @01 T 0Sj 0!000!bEQ p-LPT`S@H!00S 00 S@`VpX" -LP`0FSMB0ApP P qPP0PU 0FS UPQ 0!00C0! 000PU4@KD KSƢ,0A`P P pPPX"0P -LP@ l 0S @ PP,00S S0@ X" p-LPp,PA`0S NPpX" p-LP@`@ lP 0PS Pp -L(8",#8@RTX" -L8("(#<M $ $@ Q RX"tX" -L -L!: S@T0 $0 S80$0  S(00  S00 k1371 0- Q0L S#1@ 0 000000C0hG-000? 00X0<1L0L1 P00@0 @0S =?041S 0S `0W@P000@Ek8@0Q,>k0002(2;" 2(m"420 p-LP`h@F=?0A>)=(PU(@BPU>᧰=P0 @&?`Px0<0>(PU0(` @><PUZ ˰t x -L0P$M@0 (0tßS08  0K b2b217c! b0B!61L0 X 02D0 8  8(@@ X0H 4 0c#< n4<4 0`E8<0 P@ 40 8 07WLh.> T*Z L  d&> T0#03W0S9  R $0S(0S 3>,0 a2a217caAP0 4>40x0P W00 T03S 4 K400<40< (0@40 4 HT00R0S R D p WT:00KY 90 00 0K YFDH@4 Dp W4T9*4 0!0 S-0S L = R $0S(0S =P"| 0 a2a217caAP4=440H(0@ S40 @P" -L`M,  00 4` X0(#P8 80 p,\030#WP 0`@n==P |0| 0 4 00 6(P\00U@@T4 R /VI=<"`2 -L`,ML 0 0 0(0X S0R pD0X  b@0?( P @T 0N0IP Z * L  P  =06U !0  b2b217c! b0B!617 < R $0S(0S <0!0 a2a217caA3O<H0KAp(@T TX0<)pWH0KAP=PD0p<0<WpWH0K0 7P"xpWa -LpP@?1s  0UT  ,-0U)0T%j&j$6 p 00 0C`g@P  0 pP 0psWp -L`M , 00 0 VX \240 d p0 2@P 0#U KMZ4%Z L000  0:ppPpr0  U b2b217c! b0B!6 e; R $0S(0S ;0 a2a217caA ^C  0OSd&b&KH 0p0 KP0 RD0S  PK0Y0 0  P XG Y p0 p0 01 p0  =p01 01X 0\ l0! !Ѳ6 3 KP=Q l0!^ !A6K0   0-L@PQ ?97@R0 -L`PQp JA0` 00`PUZV  -L p8#8Q(MP , 4 80 0  P0Y4  q0 L 0 0SZ0Y0 @ L D X40 qP \< $ 0P0 0H R0H aV <QD 0A D t<,\7Q !0  b2b217c! bB! 8 R $0S(0S 8|!0 a2a217caAJ@ 0 @ ?00 LP0 QL 0b (P,80@0\@p8,6i8 0! 00 0!,L  R  R,LP 0P,@0L 0@0 < b Z< :P"|<0SnH0\H `0YML R Q,LP 0@P0@ @Q -L`("Y(0S (@pPg8P007@0<07(@T (@WTx -L pP`0 @P<  `F0 pP- 0 l2l217clL X6 000p ᚩW FɩtP" 0-L 0P 㚪@P0 000(P 0S P  |P 0 (0S(( 0!000!0ᒩ=0 -LP!(`0@pp0 뼀Pp00St0 @ 0@3<#&," @ "H0# @0 1@ 0 Q0@(@PT`"`"`" -L <` x<Q 01S<0C00=?00 @00S PP\2D2 -0@L(zZ 00csZ\2@P"X -L wM2 - 0LS @ jMT2 0-LVFdP2 R T@ 0gP  R 0 0bS00S0`"<"`" -0LS m< --? 1L60<0\ Pf0@ RL0_8<0!0Q,00Q0`222 0-LP0 M?@ 00P400!/0083? 0 00000!VMD0@ @DTPT\P M`220 -L@ 0TM]?P 00400! 8p 83 8#H3 00000!M,@K 5`(P P0P 00K00KP0S 00!K⋀P00!P 00K400S 0S lP2`2`"< -L0<0!5x -0 0 L00]<"`2 -0L`2 - LQ 0!000! 000 - LQ 0!00C0! 000 0-L4@P0@P <P0`" 0-LP@P0 0S00  0 0SP@0 -D0LS P000S`" -LPu  RpL0P@``@T ;PP0]`"$m" p-L0P@`PE@T U I]P Tp ;=?0 0  003S 4\@ @`p`" -$0L0S 0S`" -LP0 P P   p-LP0P@`T 044 40 Y?@PTU:p`" 0-LP&@T \P@T ỎP@T \P@0 -L/qpPQ /3d0  0 l0  0 t0  0 0  0 8`BP@P HPL@P@T000B1\0?-.`PR@B?00?/R@B?000 P@@0000 P@@0000PA0  $(3H9h9 0-@\0L0\08PB40S \0S 0!`00`0!\00C\00B\00CS\00 -@00 L 0  000 Q2 -@p|P` 0 0  0L0  8B\00CS\0OAU  -L@8iB\00CS\07 0-L@HP!^ !AN0K40S R 0S $0S  0,0S ! !G0 ,0S(0S 0 p-L` 5 +@Pt 0S! HP!^ !A 0K40S 0S 0S $0S ! ! 0V 0S (0S }p!@T= 0S7 \00\08kAHP!^ !A/K40S 0S 0S $0S ! !/V 40S 0S (0S >@Tp2 p-L hnVPp\0@0\0  R 0S R@T 8A40S YpU 0`0S000040p22 -L P  0-@P0LU+ 0!`00C`0!S00S\01\00S0 04 0  00  8aA\00CS\0002 0-L ,  R 0S RPU \00C\04@T 000S 0\0P0\0$U@0UP02( 0-L X0\0@0\0 T R 0S R@T 8d@40Sd02 p-LP `TM@P lKPOU,@K\1=?0 0  003` TS, (  1\P Pp p-LP`M 0S H P =0 r;g0 ,0 P) 0S 80S H@!^ !Ah.KK 0 8! !q.P,0 >0 0,0Q p -LR/`" -L `P  Z @pT PD  P ZP @TLPY/ H T 0@i`" -L,MH RP L0  0S D KT P`P~D0@3`: Su@0,0`p q=@PPⰁP00P0  P0%`VXK `UPL `@PH `F!PU 0S0H S,00* ጽ5P ᅽ!T.PUHḀ|p,'LH0 P ,0T1,0 0!`00C`0!S\01\0`2To -Lp` P'@t' ,`P 0!`00C`0!S\01\0,01,0 -L -L` Pp@t"40S' ,PP 0!`00C`0!S\01\0,01,0 zP -L` @pP JPP9 0  0   0 0{@t0,01,0@4Q 0SQ 0!000!408P 0>J -L@4Pp ` 0!`00C`0!S00S\01\00S? 8y>0400  X=:D8HP!^ !A,K,01,0BV $ R 0S  0S BP 0tS! !ъ,L -L0 P -L < @ R 0 Q X0;P 1S;   R0C# ` 0@ PB1C$# # -L, <! R0 0@%#$# -L@ 0 ݝ -L@?0̠僁 pPP㓹@P$ 00@P 000*1P #43X > A0 PP 0@ @ IBa"c" a"3 -L@ 0!00C0!S!0S00 00 0000Q  0 0,A0 1<0A00Q B 0йc" 0-@ QLU 0!000!0zP 0 1S   00000, 10000 SP0 - 1LS <! 100 100 p-L`LP7@@!00S (0 7@PUp@c"T p-L 0BSM 0`Q0S,@K7Gc"\p -LP@ t 0S PP@0 0S S  @ 0 @ c" p-LP?0†僁 pPPdѶ@P 00`PP \ 0@ @ k" m" -L 0!00C0!S  0 00000; m" 0-L@TKP@@M;*K34KK4[4 (SP 80S0% !#1<0$KS0% !#1H0$KSKD0sJ5DL0P\T P@ 40 , $ ?0#%R ~?4 S?04 S 080 ;<0 %%`0< 80 @=?0 0  003STK *\ 0 p-L` 4PK ML@P400S 40S @@T40~@ p p-L`4PK M)@P400S 40S @@T40[@ p -LPp4`P @00S 40S PPU;P -LpRM$<`K @P<P @R $0S 40S @@Tf?<0 $@  -L`Kp``MD)( K0@K348 P O 4 P 4 0 b2b217c! b0B!6180 ZU U 8'JeT @Z fQ 80e'@p 0  0038 S  (pT z'W P"`d<0V0<0 0HS~ -L? @0 0 3 0 3?a-? @ 3 0T0 0 3? -L@`0PS tK, %:QO  pPK 0SH] R $0S(0S H'!0 a2a217caA9 0  b2b217c! bB!9,BPh0a2a217caA::, d00d0߾ tP"P" -L`ሁ]?Pt |1R,!1R010,101T001&@P  ,5,00!t0 !S310 0004080@0 ,P ,,6ᚳ ,0pP ,6፳ 0C, #6h0 Q 0 0 6pW=?0,6!w( -L 8pK M PP# P408 ,0`3: S}@P3I0S@@PT84 Pu@P P 0-L%M@P K0PQ -? @0 0 3 0 3? 0K-? @ 3 0T0 0 3? 0 p-]?P,`LV 0S B@*55pkBP' 00  000 00P@,P T 8BV T00_B 0!00C0!SF p< ! -M?@4cL0S2 PP p 004,r$00!4S00!pWM?@(SDpPpP-.T43S 0!00C0!S 2ሲ40!0T3P3Q D!@1R,0|  | x00x0( R /R P =0  RM?@ =0 0S 00! 0 000! 14!|S !D1R10jP , |00|0M?@h30h3o(cP0p!@T 00 yP@p0RU* 0U:(\T(S00!M?@4Q 04c00!! -@0LI 0S  ?41D! 1! 0,0 80 1 0 S<010111d00  1S 01S011 1S01$ 0( -L? !01R81!10!@1R10+ ,0| | 00S $30S(30S430S100 <0 R01@! 1!-? 1<0<0Q1?|0S101 1!<14181L!D!H!.000d% - 1LS# 1ʠ,ʠ \1 #6!`00 c2b217c! b0B!6!101 0S 10C 1P" -L1PM}?p 0 3 00 3?0@TH `VB MP>  P%Q 0!00C0! 0001S 0 0!(10(1!P @x0 !0x0;m"Q 0!00C0! 000x1S& @Tx!0 C 0C^SR0 C 0C^SR 0 C 0C^SR0 C 0C^SR <@K  !/~Z -LpNM`1 >@tPPUoܐK 0WoK\0 #\ T@ 4p XP 0P ,P !P< T 0 0!(10(1!<M\!zP8 T 0 0!(10(1!87g@P4K @P8\0 ,0 m@P < g@P`@PT0S 0 0!(10(1!TP PP 8PU -LP?d Q 0!000! 000^d Q 0!00C0! 000 -L`M0@p Sn %S V 0d0pS gS) eSM YSs %S ThS4 QtS) sS KuS HVb 0D=?0@f|0 6=?0@f01 .=?0@f@1l &@fX 0 0K&@f< 0001@f$ $0-P 2&% =?0@f = 0-PU`0SY`00S=?0,00S =?0@f|0( -P00ӓ`&00m" -L`DM=?0 0!000!@_%@_PU\ U 0!(00(0!0 Q 0S> 0!000!@>%@P 0!(00C(0!S08Pa7@P( 0!(00(0!@%P 0!(00C(0!S8P 0S> 0!000!00S 080S0PL0S 0S 0K@P0@K QP4 : f@t4 144PK 7@P( 0!(00(0!@4$P 0!(00C(0!S7P 0S1> 0!000!00S 4080S4pP@U 0@DS (0S1 ]?PT2SX2'S0S 002T2X"0 T2X"100(T2@0CT2'@4q$T0P@U| 0@DSx c$40000@Sn f60 0.S,0SD S0.S=?0$ 0Q 0RF  0Q Q 0S= 0!000!@+$@.PU+ U 0!(00(0!0 Q 0S= 0!000!@ $@P 0!(00C(0!S6P080S )6@P( 0!(00(0!@#P 0!(00C(0!S6P 0SO= 0!000!00S 080SL0S 0S 0K@P0@K P4 : 0@t4 144PK5@P( 0!(00(0!@4#P 0!(00C(0!S6P 0S< 0!000!00S 4080S4@PU0 0S0 0S- (0S* ]?PT2SX2'S0S 000T2X"0 T2X"_000(T2@0CT2'@4:#TL0P3#400@U 2 @DP: 0S+6 4'00K00 000.S,0S0 S0.S00P4  L0S 0S s@P4n# "@T4@ I C -L =?0X"% p-L`@MPB00S 3: S9 ?0$  0 Q 0!(00(0!$30 Q 0S0< 0!000!4 4PKP400S 400 0,0K 0p -L`pMM?@t d0RP$ $3Q 0!(00(0!$34 Q 0S;D 0!000!8 08K$0 wP4p8`$3 P p$#`P U"U 0!(00C(0!SH5 p-L`P@P Q`p 0-@000L/SG]?P$#0S"   Q 0!(00(0!$3Q 0S; 0!000!'P0$3Q 0!(00(0!$3 Q 0Sm; 0!000!0 ?$3Q 0!(00(0!$3Q 0SL; -LPp`@P!L0S 0S @P @P$ @PP 0@P@ ! -L\ M   0 R/R 2"2!0L|K0  -L`p@Pt .0@m$m" -Lj&ji@p᐀!^ !AK0SP 1 PwPU0 PS 0S Q1:0 0  1@$00 P! !ќU1 2 -L`@ pM0   0S  0 @PDW @P>0@S80 0S3P0l0!^ !ADK , ,@t 0l0! !I0S 0,0=?0$30 S0@l0! !- ,0T0l0@ a0l0! !@,080S8 @D ,,PK2@P( 0!(00(0!@, P 0!(00C(0!S{3P 0S9 0!000!00S ,080S,0@P 0S (0SU ,000@S 3: S ,0P@U 3&@D: S @ S~0_@Py3: S S  S S0,0 @llT0,0@ b 1@ l20SZ  XP/@TP 6 >@PJ0,0@ 3?0:: S|@@TQ1n90 0  1@$0, @ 0!(10C(1!T Q1K90 0  1@$0A,;'@ ,,00(@,T0S0,0 X@S 00S'@!Z`0呣P0l0!^ !AK , 0|$m" 0-@0L0Pl0!^ !AK0Sp U0 0S 0S 0V0 -LP@`p8#᐀!^ !AK: S S -? 130<0Q. 0SP 1 PMPU 0PS 0S Q180 0  1@$0 0P! !qU1 0 -LP: S0("MW `vR@pK @PFX@00@,0=?0$30Pt': S  S S  S  S  S  S  >@   0Q@@@@00l0! ! 0ቢ$m" -L@`p!^ !AK0SP 1 PPU 0PS 0S Q170 0  1@$0+0"+P! !ѸU1 / -LPM@t.<`K @P$@tp<00,0=?0$30P @<00l0! !{Z0$m" -L@P 0Sm7 0!000!0S  0S0  00 -Lp0@S 00S P6PP0 13 0 -? 80<S 80S0 100<0Q00S 1 P 3: SP 0WP 1 PPU0S 0SQ170 0  1@$0`00 V  11!^ !AK!^ !AK_80SP 0PP  1 0 100! !ѸV ! !ѭU1 . * -LM`vB8pK @P6 0S S S&@)@'@%800l0!^ !A]K80K+@tP80@800l0! ![:0ڠ$m" -L@`p!^ !A*K0PS 00S P0PP* 13 0 -? 80<S 80S010<00!S 1 P3: SP 1 PPU%0PS! 0S Q150 0  1@$080SP0 PP! !U1 - -LMPuI8pK @P0 0@S*800l0!^ !AK80Kc@t` 00, 0S80K@#800l0! !юm<0  P 3: S@@@$m" -L@`p!^ !AQK0SP 1 P PU0PS 0S Q1U50 0  1@$00 P! !2U1 F- -L@MKpw1F@t&p 8 Q4<0PM0 80RH4<0QT0 80RO80\0P80 0 00R0P 80 0 0R8 80R4P 500`@ 0R0 00R8\ !880 0T0- p8 - T0PU  0R 0RQS8  R -0S- 5  40S 0\,0 , &0 80`P40@0 0Q 00`P8 0@Z 0R c 0R ] 0 R xWt0 A, R , 0R 8I, 0R B, 0R ;( m"0,! m" -Lp`P @P =V(0<@@@D@H@t 0-L@PP R `000bSP HL!-0TP@T 2 0S 0<"  -L`p, KM0` x PUh , e @=?0 (3@0RT0  ,0 -0-M 0 R00Y0S   `A `1 `RP1!0!aV`@U  -0S L!-P`0@T ,0 00S  `P`V 00`V`, `P iP-0PU ,0 `Y,Q 0R <g 0R (a0 R [7<"( 0@ m" - LR ,0  -0 0P<" 0-LP@000 R ,0  (0S-0P0 -L`M]8 ?P@<80p0 Q 10 <0 R  3: S W4 0Sv,0Ssʼ0@ (0S -0S80080 ,@0 S,0  ,0 Y00W0SWW8  0SQX 4 JW4 G 00 4 SA , KWP4 : ,00L0P4 ,Q- 0R D 0R 00 R 0劈7( m", 0D0,00, 00 | 040< @D47 p-L@P`P& @0S S S @@@@T@Q 1   Q@ᅴp -L P@p`pM? 0  003SK @K/Tn9[PSj PŴ`Pe @K KPP\0S 40S  PPOUOS0[SF P)K. 00 40JPS700s380st  Ts "000 80 0r0s 000c00 (K0 -09K 0  003SK ]\ PP -L@M'`P$| pP=?0 0  003S4K P4KUJp8@PE 0 0,0@ 3?0:: S0(0SpG14 KzpP+3[pSXhxxxxxx1 1 p0S 40S   pPZ  p፳V` 0R 0O 0R I0 R C(0* m" -L P@p`xM? 0  003SK @KT^9[PSZ P᯳`PU @K KIPPL0S 40S  PP?U9S0[S0PK 000 0KK8 0 s0s Q @0   )K-09K 0  003SK W\ PP -L@M!`P$| pP=?0 0  003S<K P<KUJp2@PE 0 0,0@ 3?0:: S0(0SpG1< KpP+3[pSp1 1 p0S 40S   pPZ  pᇲV` 0R 0I 0R C0 R =(0$ m" -00L R^ p,0T 0SQ(` 0!000!@0P000 0 0PP(0S 4\  0-0 (L0.LQ ?0L0H0S T@ 0R d 0R P0S @<0P( m" 0-P00LS @ (0S ,0    z@ R0 -L -L 0R q p-L@P` M(Q0` 0, @ 1V 0,0@ 3!?0:: S| t 0 -0 XX  L-0@8(0S,,(@-  @ ! 1 ! 1 0 0 @V ᠰ00V (z@00` s8 0@s00sdg0(D8P \p 80 I@ 0 @ P@>p -LPp@S`Q0000000Sa@a |00 -Lp`M< ,p 0 4 80 PU-  E<0@ ,0<0 0< ,K 0K  8 00S@0T ,p0<  D  00S@ @ 0TP$0U4 p,80gP748 -?(3LP , R B0S(30 R7 0-LP@P" ,0S-0S <0U80T40  S 00S S-0  @P0 0-LP@P ,0S<0U80T40  S 00S S-0  P0 0-L@Pj 0!00C0!Sa0PS00S0L0S 0S P 0R ,!,0P0 0P0000  00  0 00 00\ 0000  000L0S 0S   L0 PS 0S <\0P Ӄ00ᒃ 0T0C0@0774m" 0-L@0PS0 ( (0R 0S0S 3: S0  0 0PP0 -L 0!000!0S ( 00C00  007 -LQ  0L0L R 0!00000 !00S 4 00C00L  0 07 -L@\& 00L^ 0!00000 !00S ` 00C00L  0 0 0L  00\7 -1L`\^  0 0@LT  P1 T  H4q00C00S0L  0 0 0 0 ^ 00  000L0S 0S  L0 PS 0S <\0P ڂH0ᙂ0U0C0 `V 0\774m" -1LpQ 80S  0 0!00000 h1Q\!QS @@P0S^,a00C0 0 00@  00 0 0 \ 00  000L0S 0S   o L0 PS 0S <\0P \400U0C0 774m" -L80@S((\ L80S( (0R\P  -Lp(P(`U E@PT 0d 0@@0 p 0( (0RU^ P 7 -L@P -L   0074m" -Lpሁ`@P P <PP዁\PH 00 T000 0P0 0 Q @P1 ,0S 0!,00,0! 0!,00,0!1  0X00 0 4 00C01 O ,n"0n"(n" 8 n" 0 -LH Q @ (0 2320 0 0!00 $8,n"(n"0n" -0 L 0 p-L@P P1` SPV PU 0S  0!,00C,0!S4PI 000 0 1<"0100C00S YU 0S P~PQ1 0 0  1@$0 0P 0@@ 1 SPO R5 1R 0d,0S 1R 000000 0 P000V' ,0$00C0 0 0@@0  001@ 0100C00S (YEp n" 888 -,0LS040 -0L0 S   -\0L LR 0,    1   3: S L<" -@0P LRT0S 0,0PT<" -L$0K@P K!xM$ RY Ta@T D0S 1 A$ K@Ta@T D0S 1 A$ K@T`@T D0S 1 A$ K@Td@d`T D 1 A$ K@Tl@lPT D 1 A$ K@T$K 888 -LP`p a -? <80Q0S 100<0QN  M?@ `U:0bS0aᢢ R ! R !V 4V 1 .0 ! P!P0 ! !0 ! p!pX W { -LQ@$0S0$0 0! 00C 0!S (0S , I -L0 ,, 0    (  p-LP jsP"  dsP @x`s001S @ Tp0s 01@Dt p0m" 0-@0LS P0Q <0sP Us00P s0000m" -LP`Uphr@P P PAPUVs Ln" p-L@`TPM10 0 KH0ys0@5sTLn"p p-L@0`SprPP p  RYspR !OsP`p -LP,`K MM 0?@(@ S ,p00 0S 40S  0S00< -L!R 1R -L03: SF/ @T 0S 0 S00 0rPn" -LPpm?`( 00S 0@3: S0qP  0001 010 rQ 0S 0S Q|00!4<0@ D P1! 01 8Pn" -L`F_ApT 0 <0<S P h0SP04 0Gr@TX [Pn" -L%P`p@0S@P$0S! 0 0!000! 000 0 0!00C0!0 000Tn"D -L0pdq@P$ <0(0@@0  0 0  0 40  0 W g`qPP  0Pdn" -@0LP r 0qdn" -LX 2 232H H 0! R 0S 0 S`n"\n"Xn" - 0LS  0S=?0,3R - 00000 L 0 0 00 0 0 800C80 -LQ 0!(00(0!Q 0S 0!000! 0 p22 d32 \01    00  0 80080`n"\n"Xn" -L 0R  P  0R B p-L@`0PP ,0,0 0!`00`0!VP 0S 0!000!` `p 0-L@Pኴ0 p-L0@` P @0P`UV4@p Pp p-L`@0P`040`S4Cp -0L( -L@ M}{P  ?$3`V 0!(00(0!$3 PU 0S 0!000! :00pV 0!(00C(0!SwPPU {0<2<"Q 0 `R05`702 05"  n{ 0R05`702 0500!0a,0!`P  0S*  00 0 ha0S 0, 0 pP  0S*  00 0 0S`0S , 0 pP  0S*  00 0 0S0 0L0S TuP  0S* ,  00 0L88  -(0LS p-LP<0K@U`$M 4 40 00400<0 40`< ~P<0<@KS <0 4PC 000S 4K 4KU 0!(00C(0!S<0Sp -L`@p 0@0S ]?P$30V 8P,0 0,`0S (0S 0S #(0S  4 40R y, p-L` 4PK M@P04 0@RP -? 1@60<0Q 0@xp -L --? 1L60<0Q -LpPM@`T4@ # ` 0 00U P@UP4@ 080 @P 8K404  40 ePV  p-@M0L,0PST00#0*3 R  : S00RC0!^ !A K0 1 `' 0Q  0R "-? 40 K 0  ,3\   00 T 0!(00(0!000! !p -L`p@MPPPBT 0S< @K PP4M?@,~PP X <P PX <@:<@`V ePP b 0!(00C(0!S), | -L@p?1 6P0 <0 R aP 0R8`* ὯPP0, -L`@8M]?P10 <0 Rx P 0Sq 8pK `Pj,080S P`PP 4PL 00`0!^ !AK 1 . 0Q  0R' 48 0`R!0Q 3 :# S00* R  S 0`FS R  0S`4TK4000! !,VTK -LpP@Q *Pm?`160 <0 R8  ᑰPu@/,k080S HPPP 0 PR 0R ,QP,T 0!(00C(0!S -L0`P0) wpP  Af TJ#P=?0 0  003S rPT Tw  Q ap -LPp%88` S$M1PV 0S *|P X *tP6Z 00@@0@0@P D`K ^pP     0z  )#    0p -LM, ,c0 $ V 0!000! -? 10<00Q 0!00C0!S@l kpP 00(000@@0@,d.40@0@X7 P@U3 0U T,P  0!(00(0!@0U T 0!(00(0!@ 0U T0P  0!(00(0! @P@U,~,,sQ 0!(00C(0!S,Y 0!(00C(0!S 00S 0!0(00C(0!S0 0!00C0!S@Ck 0!00C0!S@/k  -L`P$KM@P(1@tPPUp(Kt@P,Ko@P ($ ,000@,v(v0jk$xv$m" -La䡟H`p Vt $CTn 0!000! 0P.P0U*Q 0!(00(0!\ 0S 0!000! P -U 0!(00C(0!S 0P.P0U*Q 0!(00(0!\ 0S 0!000!P U 0!(00C(0!S~ H` V -LM}?p1@60 <0 R @K L`P<`"P  \K @`P$3Q 0!(00(0!$3 Q 0S+ 0!000! ,\000!^ !AK`PI @0 1` C 0R 0Q<\ 0R 0P4<0`\/ X^,  0`FR' R$0 S  R R0 bP xPK<@K<K `ᢿᠿ\000! !ѳ,K⏿\K⍿@K⋿ p-L`4Pi@P 4*0 0 $000,P\@p -LM<0 0<\`Q @ !^ !A]K0S:0iP RE Z @1@!=?0 0 0 30R }pP d 0 0dS 0 0P@ Z~ ,0 pP" 0R6:,0i000ViPv p00K,00Kp@W w,00 0K,0 P 0R P 0K P U *0 K8pK,0 @P t,0=?0 0Z @1@!  003S pP( 00dS 0@0K 0@0K0Y <  0@@0! !ѭ  p p -L@00PKM`000p f 0S:0hP  Y0P@ 8P,0$ 0R4 0K0@TS0@0d00c 000K0@KP0 0Q  ,0 Z z,0  P ,0  ,0 h000ah0S  0 -L`PM\p, !^ !AKS S( 0P`V" 0pW00X  VpǏ wx   0 00 0p 0`, ! ! -\@Lhh -L`@ 0TPp P@ 0S0%# 0%)\00$30008010000000@T U:00c 0 --@ 0LS *c 0 0 0S3:0 0 -LpM @^W*? $3`PnU 0!(00(0!$3 @T 0Sj0 @d0c: 0!000! 0@@U 0!(00C(0!S@tVPU PP 0S \00%300080100000000 0 - LP -L0@ -L -L`P1g p@P <0< < P0 JpP\00 gX| 0-\0L,@Pg0 p-`\P@0Lg000p -LPP  Pf ubP  -LQ  Qugab -LAM`\ }?p 0  003SJK,Y@ TT!@TIPuCV @ 0  003S @ T  * 0^@S! @0S l0!^ !AIK0 JK 0@@0l0! !L -L` p  \1(2\1 30\* 2\ 0\ 0\ 1\ %(00S!%(00(00(0 0(00(00P (00(0 0(00(0(0(0$0<1\0C\Q Q 00P 0\\Q=?041SQ&.P"-? 160<0Qt T0\\ L0 \\ -? 160<0Q XX p-L4@K  MھPP400PdC᮹J TPEᾥPp -LP@pß UM` ʘ3U  Uڝ3U 0U d3U6 0UY <0Ua 83U ᾸPu (02@ d(0-? g0 0  003S K 8PK(0  @PP=?0 0  003S8K ]P8KU (08 K |PK(0@PD{DP=?0 0  003S|K 5P|KU z (|0KrT (0jp=?0 0  003SK pW R(0  K|PK(0@PgD-pP=?0 0  003SK PKjU , (0K($XX$m" PK(0$@P8p=?0 0  003S \ 00 -LQP (0S  \$  \  \  \  \  \  \  \  \ (00S%(00P (00(00(00(00 \!  \  \  \ ( \  \ " \  \  \  \  \  \  \Q Q 00000S \ \  \ !a010S \ \Q=?041SQ",P-? 160<0Q \ \ \ \ -? 160<0Q  -L0 R M0  (0$ K -Lp\M(l0KP%\0KP`Dl0@#T0Ld@4P<`Z 0@P`  (0 K P0| 0  -L` V V p\M( P 0P K@0H K@0h K@0` K@(00(0  V V 0@#+0@K@X0K(0 0(0   (h0KPX V0 KO0x KO  K(0l0  -Lhn" -L@ T`(Mpj  T&  T  TL  T_  T\  T  Ts  T& ]Pu (01@av(0pV (0hc@=?0 0  003SHK @T OH J DPK0@PA =?0 0  003S0* P=?0 0  003SDK PDK`U  0DKD@K^ =?0 0  003S \ $m"00 -LpM D T T` pwPp ; S  0PP 0-  0PP 0PW  - 0L 0n" -D0LS S 0 R R0S 00n" -@0@L @T 0ST P@n" -LQ 0!00C0! 000 -L@@K M]?PKH0KM?@ 0 0 3 0 3?@K H0KP U UPPPfl $0S @0 (0< S000! !" 3 0X 0: 0 3? -Lሐ0 0M!^ !AKP0K ]?P!hX 0 T0 0 0( 3 0 3? HpKP`K0@ T T@@X <0h1@ 0 00 @0,  0 @ T@ T@0! !ѺT  3 0Q0 0 3? p-L@"M0`S/QU,!01R 0 0!(10(1!^ QPmP  PR0r S S00 0 S S0 S S 0SK0 0 00S S S0 S S000 S S 0S PKtJ yP'  1R0 1 K mP 10 1K dP 10 1N0s 1岡Pu#!p -LD0D @T`3P=?0,0L@H@ -L!Q a=?0 0  003S -L`|p|0M0W,0   PbP@p DWx D 0 c 0 cP B8!4! B0 0@c@D000 0W @D 00 0Ph@D 00 0, 00 :0 00 S00 a0C0 000 00$ 00( 0C0, 200 00 40 8 000C< 0@ 00 D000H 00 L ?010P 00T 410X 00\ @10` 00 dpD100@c0@cPQ@D0@D0P0@D, 0JST`X` 0P` 0V03S0@SQ*` 0JS00]?P I,0R\`X` 0` 0V03S0@S1*` 0IS00=?0,0`` -L0`0M80 <0 @0 1D , 0 0C8S1(Sh2  0 Q0  $0$0,0S 0S 2 S2 SB TQP4 0,4 D P pD 4P2H Pq0Sg}?pP  X,@@0@ @1< S00 0L0 =8L0*"*0b>0>0| * :#:S 0,,Ơ-P ,~PQE< R 1SL< >00c80 8 RPQ1aS* D '4! 8 R!0@ R!@ H  H 2 PR %>0@0 S `1D P8000D0 4QD -L@M-? ,0<00(P,0pDP 0, 0L0 l0R R 7P0R 30 K` ,0$ 0S S0 0  0+ K iQ10S \  (0K P > :1 -L M  @\K@  @@ `,s \K 00?PS4[0C8SN4[(SK܂  D0 QD0  8080710S3 0S0 3[ S-3[d"0C8#R': `3[BPP  @0᳝`V V``]?P(#! Y`P(3AT w`P!0!000!@`   r#[1S0 ^0SU`0 ]?P,  1*"*0bp>0>0| * :#:S   0 ,Ơ* ,PQ 4[P NS  >00c   0R01\1R 0 PQ1aS: 0R!P020#S1S01  1 R! @3[^ D 0@ 0@  0 @  F`P ?WQ) RK?K K\ 0S `1 ?ꪪ*@T 0 0!(10(1!{NN\  v偞 m?` $!@@@P\0K^ Q,PT@K@@T@,0 L H ,0@<@,08,0@,0D, 1P0t0 ,*0P*,00A1 0 3 00 3?Hnt05 0@0@0D10 @0 0@0 0<014000000 0   `jV`` ?  V``@T 0 0!(10(1! dz\ UNlu^ M?@(W(HN8<4! -L`X@K 400>0b~ *:#:S  0.Ơ), ` >0V0 0>00Q`^-`M4! -L0@ 0 P 0-0L\ @_ 0 PQ 0 0O0 -@L00 0 0-LP M@ 0   K P  P P  P P0 -L0"KM}?pL X2 d P |\ ,0XX@D` T 0OTO@#  003S}K bT }K R*}K0S 00 R:K }?KPPҿKPH ㆾ,UK ,0#`0@X@KW@KV@K\0 忿 (0 4K40$KKH@ DP @0 31(K@!0R0%!=31K  p0(KiOKP0x0 7>| t0 pp 儷P ` Q|  %%0h0 r0l d0 `@ @`PTKxP`"@T< X2\0R 0 SX2 0@2 0C82 42 ,2 (2 $2  ]K 6P >0. SC6B6,@ `T> @N@ < 04 82  0  0 ,30S 030S00S0002 ,  (  0(2 0(20(2 X\:$2 PX  P @T`"@T KP `2@TP ,0@Tv  0  0 10S010S00Sa P0U]* ,000KK0 8P PR Dp1D"0R PF 5HP0 R  D"aX0\ʌX 0\ c2b217c! b0B!6$*vP D"00 c2b217c! bB!pDU0ZU: @T  Q < -T? 3 0P 0 !P" 0 3?,7 -L$0K@ KpL!MP U 0PU\  N~- 0S) @ 0 0 Q 00   0\ 0000 N$0K ~0  0S$P@ 0S P 0 P P (<0<DJ 0!00C0!P$0KU` -L@`p01 0P M, R]: I@PH U `0 0`刡 IP: P 1   00P`VP IP " P 1   00PP`V ,0  GP 0 @ @(<T `VJ 0J`VZP JJ p-L 0K@ M@!%1S! 0 0 0K @0 @ P 00   0\ 0000 @T` @P 0S P 0 @ @ 0<{I 0!00C0!@ 0KT`p -L$0K@ KM@`&0S" 0 0$0K @0 @ Q 00    0Q 0000 @ Tp 0 0000$@P 0S P 0 @ @ 0<I 0!00C0!@$0KTp0SH d<b@gG 0@ -L R`1k#M ,0 04qVNP 7  <pP N,U ?SR N R0QP`d=?0 0  003Sp   , 0OeN -L=?0h3\0 -L @M4  m ?`,0 4QU 0S 0 0S9P\4MP0 U ,pW 0!000!F \ h3R 040 = 4 4X2  0 00 X01:#W@P U 0S 0 0SP40S040  0  003S 0 ႶP4 X 4 ,  0@V0M4 -LS S  0 0@ 0 p-LP@?F0C 0cS 0  003S  ӵ =M -L P0`M?@<8p$0 \ 100 <0 R PP K$ K<PP $0uP $P 0!(00C(0!S -L  M0`4!p8 |0V<0  V (0  (@@ P^ 0@ < X80  PH 0P@ 80(sW 0!000!5 0 `CV.*0V0517S 0#N4K1! @S0  9@P < Pȃ0 n  P 0P@  `V:4 8  -M0L41|0S,0 Z 0`pV V )0  (@@ P!` 0@@_0  `P P ` 0P@ `F V#" 0b4 8 \? p 0, Ȍ0P, P 0@`0S -L, R|0 -L`pPP 00T0L0P0|08(0|@T 0!l20l2!W04a80<0 P 4180D1<04A <" -L -041L|\ 0  00 -L -L`p<@ 4QR 00SM 00C QH$1VE1`0 BS)@P9 (P 0!000!, 0PV05Q7U@Q# 0!000!0 @0D0l0 *#<11=3130380L0闙 ?,@ -L@Q4q`PQ  @0R<IP0SW  1@PP 030A S:DԴȴ $8dX0 4 0,0 0 0 0 xHĢ=>t>=< D@ -Lp<`KP@ M=?0|0  0P\  0-L4PK@$ M=?0| ]\ 0 -Lp@@00P"P" -@L00 0 0-L@ MP 0   K ) P $ 0P0P  0P0 -Lp@4p4`  pP`2M0PPP0I( 0 p20! `1P  $ 帢b"##00      01C 0 :01!  @Q 000000!000 p00 1 0 :0  QK Q0d1 `! \ hQ ZOKakpNK | 0XQ T1 P! L 0 (KR000G?KP CKVOK=Gp-? ROK0D1 7>HQ @1 6rR 0W20C L06& 80/T  a0'(($(,(8(L0$D a0DaZ  ON@(H( -L  0 020CL( -L@taDM0!l S \p @`2 1y@m ( R063AhPK@ :u@P *T`v0"1p ĠK 4D 0[Q 1SP   Q 0dPX 0@S l0 P ,00S FT(l(|( #FF(@1SLwW` 0 6vl0 CR  ( -LP `2$M 1<0 00YQC!21`upP ,0S 08@K@ I0,$ ` P'r0< 0(a -L`RhM‐ 0 10 SX d,0 S 00 00 (P qWV eK= h@K|tPO  ֩ (hK 0 eK spࠟP s}PQ0x@K0 00 @ h0K 0|K@Fs  @d0`$Pq000|Pt(0S |t( r"( F((a -LP@R 0pW 21D`X  210S 00S00r0 0  +D` 0pWX B0A0r0 0 0 @ } F -L!P 030 -L@`0 PSp!0V0"1` ,0S 0  XV*  R Q01 01Qp 01 !C0S Q 20 00D01Q$# -L`pP 0@l0 0@t!0 0 @h 0  b2b217c! b@B!Fn900P" -L@ 020C  ݬ ) -LM0 Ÿ.40 0 \20C<0 .8 01S?0Qä@  24 p8 @00dS@0 <0 0, KP "0US00SQ{ oO@P 0 486 0`S S S`V+0 $0(,U0 48<  8  0SQ:4 0R 0  0S<0@` 008 P@U@@DP  0 4 8 0 S S S RP@UU 0  $0 (,ᚂ' 0 48 <,80 8i#,8 -L -L`p@\ 20 0 PU S SR SU8D\ 0000) -L@T K0,M`<pCPP/ P0R Tb8'P K$ 8@S`VWEV) 0S  0@0D0eCV0T=8 ) -LM$) -LM() -LM0) -L -L -L`$ KMqCPr x!0US00SQ$7ao@P  0 4 8 0?0S 0?0?S0`@T UR0 TR0 P*0U 0S 0US0\0QR SR@0 ,0 $78)@)L)X)d)$7\ 0  -L`M4  Ƞ,<08  ^20C<0 ,8 01S?0Q40` @ [P4, KpP @ 0@US00S@@T,P7#oO@"00000  0 4 8<,  @$(8," 0 S S S R 00PxU0 0  040KjD`@ZZ0 US00S  R' kO0<@ 0 4 8  0 4 8<  >00Z0 @D<0`FoO@,  0 4 8 0S 0\ !00S 0\T0\  400K `@ZZ,6l)p)t)HFLF -LP`M  V:hh 0$A@pb,1AT  0$***X40@ -Lp@P M`P  p]P00 0p00$ 1]/Pe/0+D+ -Lp@M 1`V:044!0#%S!e?0S ]?0S_  $ PT00W t1S 00Q]?1S00Q!]0SQeτP B1@ P  A UtaQ'!$ 0S00+*++2P ]]\00CP 1C@]? P e? L  `p2 -L  J( Q@$ AQ 01@bQ 01@Q500B00cQ^ 01@@0BQ%0 0  p777 -L `嬀p 0@M0P S PP  Q0 0R Q 041 0S0 PUP [P 000 -L@Q101 P0 0R P!1Q100SMP40 R0CS*P 0(! 00   -L `,M@  0 O;D\ 4 UP04 !0 0 00TeDJR&@P 8 K ttx0冴0 00R@T<@  LP@0X H0 PL @ XT6767Z0@JP &@TZ  @P  0,@T< -Lp`MP< \ $@P 8 KL 150 00R@pT= H Q0 0R Q/ PU+00<0 101010 T0Q Q1 %@P 8 K ,,400 00R@pTT676<"7 pYP@I *&@T w YP @  0@T -L`8Kp\Mt x  l  0R0t R0S   " Ÿ?帳00X*  hPK0lK6@P0 000H0dK c!`0 @B000S l0s hPKTP N @DTlU sE  0xp pKBP:i/| ! d1248 B e 1248tp0 @aPl tx 0l |^l0 s SD0g0R1Q0 0TP UN @DT 8<8T8\8 -L@P`pSM =?0pCT444 46>@ 0; 8|8T88 -L@tM`Pp0W0U0S !1@1p@ 0 p 0KPvp0s 0 >Mp0` S Whhh!t1Բ@U `@@@!T1ʲ@H @P7#pP  K 0岲0 00Rp@W0 Q 4S pOH]$@P  K xTx0呲0 00R@W@T V@ M` \8 88T8o8y8zT667 0-LMPP[ P 00 Kj0 !H0@P oM000 -Lp`@ M, 帀PR030# U0S  R 000 , 0 Wp W(@U00T0S 0-L@Mk"PP $ K" (((0 0 00RPT6860 -L@ M P,0p !0 (( p;pw`447H70 @R`P3: S0 01; S0 p1 00S   ( X0j`V @$0 T@T0  EI8 -L@p` M"PP , K 4440厱0 00RP .JT686 -L@p` M"PP , K <<<0j0 00RP  J{LT686 0-LP@M#@P $ KY (((0B0 00R@T6970 -L`@M? pÜP0 3: S01; S p1   R' 00 , @, K pP&$zf( @P,0`SˌD 0UD0T0101L01; S 0 ( 0`V  0bQ`Dg 0R D 1R 0 V`0@#0 T@T0  VK$9 -` L1p 01A8PJU RE -L0!000! -P M0L p`0Ÿ"2u`?p3S60  ,0 ,0 @ !0 !@l@t  R`Z1+ R 3: S R0p1 00S Y (0S L 0(ʠ  oQpS`Y  0@@V`@"0 T@T0  <VH9 889T847H7PEdL⻋ -LlNE -L0 00  $ -L0 00  $ -L"ƠJM (p `0F0@0  @0 0c@0 0 P 0cCP (0S  L (0X<0 :@ X(0*<0 < 0P  0[<00 0 <P<00 < Kh<0P ;E<00 3: S0 01; S0 p1 00S <@P 8 Kh 1Q0 00R@PT}@0S h!0@ b2b217c! bB! R $0S(0S  0  a2a217caAD3P: S01; S`p1 ``V < @P 8 K  ((000 00R@P!T6\96P"701; S< , @P 8 K HHH0Ԯ0 00R@P<I j"T6\96 -L`VMpA`FV0S $0K001PP01 PC0S00S*@U04 R*0S 00S @DT ! BR00T0S00C0000P I PEU -LP@M 4P1 T  `P 8 Kj 1S0 00R`&T @P 8 KN 070 00R@` V*pW @@0 F0 px` V:0 T6x976 -Lp`PR M<  W@P 8 K ```00 00R@TB0@T*PU W 0Up T696 <0@gp0@T:W  <0@WZ  @P 8 K (((0巭0 00R@T697 -LP` M<0 00000S  Br z L0< 0 Z#1@0 x:pWe 0 H@Pp!(0vW4 @ 0 00000XL,P 4 0)Y*  @P 8 KW 0@0 00R@T@ pP 8 K@ <0<0)0 00Rp< JZ* 99T667<0  -L\M0* R R 0l0 M?p0 !At@  Rt1S$ : S`0SQ 1 ' y0Dx `  0@@0Op 0  8@K pP  Px g?i?|0 厗W   p@8001T  h@K0l`K`l0PS' U  0\Kl Œ Č ȌN @h0  0 c 1248 L0h0K`U  l Œ Č ȌN@04 t0P zG PEU80 S&  S S1 p00Sl0  l0KhKp 000p@40Sl0  l0KhK040p80Sl0  l0KhKwp080|Q0 0 T0P0Z0,0 1 00040S  @0 T@T0  8<"9 -LPM(\\ 01\: (10\ 0 >@L5 1pW% % *1,!73!1R0C| %4@B0B 6LF P 0 0 4 p0C`  99:(:@ (0 9@: -Lp! 10 10 1  10 1 10 1 10 1 -Lp,K MPi,P(0 8 <1 788078<01400D @0L0 0T00P040 S|! 3S 0-0Uw cFt:\00!`0000d03 :p!h  St!l0x1Dl` @0P``D0g/$ d0!01(P(0 M? e?  0 : S 0 0% S0 0  St1S0 0$ : S`0SQh00 `0H 0 L00( 3?,P EB ;"XGGGGF@IH4Hc -LPpPM`  @P 8 K 2嶪0 00 R@T1 0Q T3001* 3031|1S373 ''80S1%0!310<0S1%0!3110773g/100L00T0 0P00`00|10p1 0t1h03 : Sx1l0G0l00S@1s=(!d0 L0S5$@P 8 K` 0I0 00R@TV (!d00d000000$@P 8 K? ``l0(0 00R@01d03: S   SQ 4(0T6t:6%%7PM? (0  @P 8 K ddd00 00R@Z101Y EZ   T6t:7 --? 0L p3SQ  -LpP@`P   80R# <0R 0 0  1@Q1ɧ$00$0P0 0Sy``3: S;08 H 0R3D 0R/,0@ !0  @ @t`(`0g/V`@80 T@T0 l 3: S40S 'V  | V47H7: 0-L@2P P3: S0 01; S0 p1 00S00000 0-LP@P 0!000!  1 PR D 0:: -Lp`PPM pP6@P 0 K ```0֨0 00R@pT P C00W   T6:6 p-L`P$@K MP p p-L=?0pcP,0@ !0  @ @tV 0R XX刨@]0 T@T0  p47H7:; -P AL0`,0 n0Vp19p19p1,0` !0  ` ``vp0@00T@T 00 , l W  f 47H7(; -L`M@3R :CR 0R 3R 0CR 2R p1T0,0@?P44@\0 0T T0< T| @P%*0S0U P | TPP  0P XP@0S@T:PU PP AU`t d0V`#VmD0\0 t`t V*d at=aP ` l0hS l x0P rAlh Ql ` -L`M@0pS#" K"PP 0@WA p0ᣖ@P 1@ 0ᐕPT  ᎍx -,M@0LSH0 0@ <`D 嬐  0  5P< 40p!0*40p! ᱊@ 0 T@T0 @ x<040uD=X=GFd<=<=G=$= -LpD M0嬠S D0S  0,K0 @P00!(0]4P(0 R 0S PP  (0?0 `P01T 40 0U:T =0 06"a@P 0` 4P 40`P 0S T ===== >0`PH0 SD0ST = -Lp`$M⬀PH0H0 !^ !A{K1e SW3: S S S 40S xxxx!x1}p$@P D K D4@1n0 00R@pT/4K npP((10|1(!(00$@P D Kb 0K0 00R@p ,WpW11>0ࡈH0! !K{W  e>8>h>x>d<<$= -Lp` M0PH0!^ !A{K!eRd 0|@嘡0 qpe?0UU 40K H0 pPG>Z-(=@P D K DDD1ݡ0 00R@pTA,0萃(@P D K 0š0 00R@p eOJDK pP! |pWH |qpPW P 0H0! !Ѵz4P <$= -PML,0@` !0  `|`vnp$KKPU 0,0 1 000@Q1}D=X=0 0  1@$0$0 (0pR0"pGP+ $ 0-pP$40S   0D00d00 4p }40 0C400P0T0T0[p1:p1U@0 T@T0  CX <>?;"<" -PML,0@` !0  `;| `vf0,0 1 000$KpPC @Q1D=X=0 0  1@$0$0(0Q(4 R0  P040$ 0P p1 :p1P T 400CS40T0T0@c0 T@T0  W ;$?0?<" -Lpᔃ 0`V#,0 0 PP!#o z 0,0 1 000 !P@u<V 0 0D@P# M0 0zD 0FOD0g/  o@ P0 UPU0 H O 400C40KD=X=HG@IT? -L@`3p: S 40} S#),0P !0  P7 Pu0,0 1 000 40 040T 0!,00,0! p@0 T@T0  D=X=<"d? -L`@(M,PL  0 !> x:0,0  10,0 1 000<KX0PD0 H p <0 (0R@K@IP T ~:Q1〝0 0  1@$03: S$T &0D0 P  0D DKPL 4 0 (0R0Z0T0S0D0  40} S*Y  PD >D=X= kPP 8 K" 2 0 00RP@ (000(1`0<0@ 00!000d0 PP 8 K tt|10 00RPY 9LQ0T0< H0T400C400T0 Lp1Q:P T p1D LPP 8 K 0崞0 00RPL 40(  LgPP 8 K DDL0回0 00RP40T0C40 400C40d<p?<;"$=<" 40p!0*40p!T 40S0D0 L0S 9HQ 9Y {9@80 T@T0  Dp? -1L@ (1P P 0-@-0(Q00303,0LP 1<1'PN8˛P$,00,0 r0@@ -p- L `P0@N 0r"@p -L0 s@ s s `\P 10 @ < T ( 0cÄP A(A8ALA`A p-L@`( KMPN 0ᯝvlAp -- LPpD@@`堝 ❄LP vN 0GAr"AlN P0ᇝ,0<傝-000,0!0,,0!i&A@ --`0!40S D0$$0( 0PƙH I8I( ⻙ដQ `P`Y J RPP0P 0Z J R 0$ 0,0,0LI8IIItII -L p`@F wpP wp w wp046Q/XWp -L@{P`M< 帐L)4, 0 4 ^ 0 1S W p{,K ,00K⸀开P㸀3  pF W ,y< ,y@ <]4P8 8 40,#d2R0  40S I@ L0S (!\0Sd0S`0S (!`0@ I ,0 d0@ I 0 00 02+C R 0 I |ԘA0 0S. p W*D Ř8 R 3  E,@Ey< 6y@ <3P8 婘8 40,#0R 垘L0S00u0C0 % T0R00BR\刘~ ;W 8 ~t#ISI,JJJ$K\KKKK L00 00$0 0(@@y00x 2 080R(0500S50#, 0#!8#8SA(A$A"A!A!8#8SA(A$A"A!AQ$ QQ0 c@mx$@hx WP0L@ T<  2300001S @ TP@!@T80ppX0px0p0pssY 2" 0$ 0  0 4p0S(1`0 p1 (1\0 0 R40S H媗P1 Q Q  Q  0P0;0 0;0  0 Pd僗j 0@P 1@ 0؆~P4 3: S`0S D0 00 4P |040W>T;,  M000O0W08#80 \>1+ R <<0 RXLLLL,MHv"XMMMMN\ETE  !ELZxS4ZS,0T  z>+000 CgP 2&0     R hTTT \0 00@eeeexS4ZSZZ -LPp M0`, P(0SB ,0唐!^ ! AcK(@0@ V0(P  fP,Qt 00 @T! ! cVX /P (0S  0墊`ZxSZS -Lp@P`M0S!1冊0S S !1y0S 0Sn VV VV fPfP 0S PV300S  0B00 0S9  0600/ p$p 0p00(p0p4p8pp R @@@PYxSZS[X X  0 0 @@X` e -Ld -@0L 0S $% p-L`@M0SW`'f`P`K 0PP0700S 4444 40ƉPV ed[xSL[S]p -L0@/$ -L@Q secO p-P0L0S8@T Pe`P 0!000!$0.rp$p -L`PM0  0!00C0!T0T@S \0P`  0 0000\P!^ ! A+_K 0S !100$0S !1000S tXXX!h100,0S ,,,!@+>0000S  10040S  0ޅ0080S  0҅00(P R ,0R TTT ?@T  0  S0 ;9\[[[ ]]]$^]P^x^ P } @$0S W!?叅00`0  @__0@  @@T   @,,,!41g@0S !?\@@X k (0S|0S  0B000000W ``` |04000 0 0,0S 4 R4pDpHp[[[^_,_T_ |_ D H0H0HpH0Dp! ! %^P x 0-L@QPJP  @TZ0 -Lp@$MPe0X!U&* H K `P hڄ# H 2P ` 0D@KpW  S=p_PU:W D KC=`W DK -Lp@P`M@0V:0 00㛄@ K@P ᑄ'  @P  0 0 B00uT `_` `_4`@ -L4Q 0 00n0S  p-LP,`KM_ 0P 0,$,!$#,  5@P /@T (@(00(0 0 Bp 0-LP(@KM_ @P  00``$00$0 0000 -LpM 080 R4 <4< 4.< 4 < 4,l,K /@P` V0%0c `c ,43 R<4<("4!< S<4<("4!< \ S S S 40S  E` V0%0c `c 0 SP0`,$,!$#<<0 V0%0c `c 0K @P 8@  ᇃW00Sppp"pŸq?|@0 ,#LP 0P 0007 @P ^, @P u0Pv qtP_P@ 400 4]<0,04 d10@ _00P00 NT J<00<0,040 0c0S},P 7\ 240S \ )   0),0@S T40S 0 0cS40S 0 S 48 80S080 8;9`_` ```` -L@4p P,.lT40  @8#" P 0T0 0 -L 0@S 0'   p-L@P/000! !ѭ[ۀ`!^ !A[K!^ !A[KaP! !ъ[QPp -L`, PG P,p@0 0!000!0! !e[0 [)Q @*0! !M[3 (P    R& 25U 0!^ !A[K -Lp` :P0S 0PU A \ 0PU00< -LpM@P`Q40S10S  0́p 0!000!`0  TTT X0庁p ]0A00@S0p8ahaxaaa(0 S@@P0p00 -L0M,1 AP= 4`V3 ,@001 p,@4A @JK KK 0(pKP4!U00T0S,1SU01SP 0ZPa8aaxaJP p-@M40LS00S ` P,0S``PU,,,, ,02P0S b8abxa0cU05 500b0`P 000p -L4PU H P,@DT `,p@(`HT U -$LQ @( ,0$,0, (0(0,0S(0,0,0S,,0S00Q JD s -L p-L@`M00 P  PPUdddd d0巀P$0S <<< @?嬀00$`,0S,@(@ Lb8a0bxab(0,0,0,0(@(0,@,@p -L 0-LPMD R H0H0H D0D040SD04040S0400S HŸHHH"H2p000S " Ÿ?d00 0S Ÿ!1X00$0S !1L00(0S !1@0000S \\\!|%>40040S \(((!P1(0080S 4 (100,0S  100<0S  ?00T T0R@@TXXX 0@000S,,, t?00b8abxaKbcMDcNlcOccQcRcSd8dUXd0 p-L`@Pp0PWuP @&0A#" A!"00C !0000p4v" -L6 @2# @ 0# B0 1 P 0S P p-$@L`PPPp4v"8v" -L@PM1S  0l00pqP 9 0E ||| 0X00 1P  1 1`V  addde8v"$eP 11  ! 00P -pMQLU& 0`V 10S@@TL0LLL 00 @0`V$001`edHed8v" -LPpM 0` P 0S  0~PCPW  LPU" @03 dPPP X0~00ZZW  xeeded!eI@!^ !AWK0 ! !ѴW -LP@0pZP Z``XV P  0 0\ 000V 00S  @P qXw4v" -Lp Ma0 (0 ,0 X0!PQ  ( K@,0K@ 0 0L 0000S0X(Q , @4v" -L` p1P@U 0T )PUiPP 04x0040<4<("4!<0 @P0 <4<!44"<0@@;9 -L@0 <4<("44 < 0 Y@W 0<05 p-L`P@P 00cS@p p -L@P `P p-QL0`V0!@Q  0 00 000(0S0`Vp4v" -Lt -L -L`1M`{t3t00!M?@/P?P8S 0P 00000! [dPp 00KP0P $@ 1@ Tp p0l>}d0 B_P!0P& 0R 1S 01Dv"et QeI .phq,Q 0S t0L 00bS000 1S 01從P 1@0A@@ p<" -L@ ,)wP!q0S  -L@ 0R00 h oP q0S -L @M8 < , 0 40 00     RXXXX X0|<  0S Z%Z1#6( 8 0 f,f\f|fP"04 8Z%Za0  b2b217c! b0B!61!Q @< 8T0,0S% 0t0@0 @ VP1#6!00 8 Z %Z b2b217c! b0B!61@PO|qT ` $` ``00vp `0<00,0 0+\ 4000 p` , ", <08P";9\fP"f -L @P@ - @L0Q,Q @0dSh@ o 0-L@0Ph nP!p00cS0 0-L@PM0SXXXX X0{00 0Q0C000  f,ff|fc0 -LPp@`P bmP  p,0$$ {@g]wPPP0S VD0DDOw0PV -j,fj|fp -L@M0ST0TTT 0u>"u0000CS0 0S @/m,f|m|f -L -Lx -LP`M  V:hh 0AJUplU,1AT  0mm0nX40@ -Lp@P M`P  pP00 0p00 1]/Pe/nn -Lp@M 1`V:044!0S!e?0S ]?0S_   PT00W t1S 00Q]?1S00Q!]0SQeτP B1@ P  A UtaQ'!$ 0S00nmnn2P g\00CP 1C@]? P e? L  `p2 -L,M4 嬠8 Z$tHP !^ !AMK(L 0Y:80 *0R ((#8 0L@D Q @dYT`{T8 < 0S0e cD0 8 20S t1S1S  1S !]?0Se?0S &P e?1S  R e?1, K00 PH 80@0 Sc*H0Y 0Y  Y:100CY ! 00< 4@0OP x! 0;4@ Q`P0 0  4$0 p$;F4pV` `X c` W46 B` <64 60g64:^H000L 00 0@8 Q@ :,&$$0",0 0 K+00 D0S 80 ; oHo\o2oo00P! !LL -L0@2`Ƞ,S`02`05 ,@0(0c-l h d ` \ ,<(0 H 0 @JP"pp q@q\qqqq0@@ ,@ (0 Ǝ4 @JJpr 0-0L 0 @t0P Ǽ0 0C000 -L4M, `@K`.D @Dt 18 0@D0X0 t @V`V 18 pX `  -L@ M`(p^P0 0  $0 1 0S= i$0H040 !^ !ACK3(: SX1W:0W|| 0 B@GQKY@P  H8 !^ !ABK(!4 :  S<0 ipw b0s, 4D1`V*,04E,,0 , KH",0 }1c#!`V:40V0"` 4 00C0$n?00<1801<0 3  ;<<  Q< L1<0:\0\":Cⲓ(``00H"PPT0L0P0: p! S p00p1q-Z"001009T8 ! !{B۬0 0  Q1wg 1@$00$0 P Q 1 0S=[g$0 $3 303S= 1 4 @0 1Zy40 K<0 Q0010C108 ! !%B\Y 8H 0 ,0`0 K`0 ss<"z;"s -(1L -L( 0-L@~\PPx001S0,0 1 D0 `0S  0V0<" -1LS f? f?C11w p-L@PM`\ U 0S010L13: Sf/e?`Y 0`Rp p-L@Q` 0Q#!> ( Q@$ AQ 01@bQ 01@Q500B00cQ^ 01@@0BQ%0 0  ptt t -L `嬀p 0@M0P S cP  Q0 0R Q 041 0S0 PU 000 -Lp`M4 , K< 80 0 N@T@M p PA0 F0 00D@PY 004 C0008!4!000C0y00m3: S0,0 1 0 KB 00 w @ Pp4 W< P40W WP@G P @TWP@  ]@T, -L8 KTMt l x0 P)  8PK h@K0lK4`P J dKhK0ః0 `A⼀!00 x R l0s h@KVP q `FVl s 1pKp t 0R1!01T h0  Q0 0R Q"1t R100SMP40 R0CS*P 000(! 00#00 0Sr ! f1248 Bq0d!"$(00p 0`Pl  FQ h0 Q0 0R Q/ 0S+00t00!101010T0@T v3: S0,0 1  K0 Q0WP@G P @TWP@  q@T 0S0 00(h@KVP  `FV<" -L8t -L 8t - 0L8t - Lb8t -LMPf8t  -L`VMpA`FV0S $0K00 PP01 PC0S00S-@U04 R*0S 00S @DT01 0CS  TQ00C0 0000P / PEU -L@Cx`M) 0 0 T#K*PU 000 1pPP (0 40 ! P@ T:&P T*pW U00 0eXP ,t@tP P@ T:U P  -LMPM0* R R 0l0 !1p0  R|1S$ : S`0SQ 10t0  D0 `  0@@0Cp2  8@K `P V'0tp80`AT*PU W00 0gVp +P  #`p@T:WO P  G  hpK0lKl0PS U P@  01 0l Œ Č Ȍ0C1hpKU 01 0b!"$(0C1 p@4 !@P  PEU80 S!  S S) 00Sl0 000O lKh K040Sl0 040O lKh K080Sl0 080O lKh K0<0 0T0P0,0 1 c 8t <" O -Lp! 10 10 1  10 1 10 1 10 1 -LpM(\ 01\: (10\@@# 0@LD 1Z %#% *1,!:31X0CP " {D402 04\PP"(0c 04 0C@03 8 <1 788078<01400D @0L0 0T00P040 S!3S R D}:\00!`0000d0 0p1p0t1t ^? 3u : h  S|! Dl` @0P``l010d 0P1刡0!0PU(0 M? : S   S 0 0 S|1S0 0$ : S`0SQ00 0t 0 p00( X 0,1dtttttt;"yzJ@JKIJ`LLTK;W -L`M(\ 01\: (10\" 0LCP 1P%"% *1,!03!1R0C, hp"(4@@C1B 07AP, @"(0h 0!0Cp04 P Q >3001, 30311S373 ''80Sp1%0!310<0S\1%0!3110773@!D100L00T0 0P00`0010p1 0t1p0^?0t00u0|1h03 : S1l00l00SD0s@(!d0 L0S(!d00d001d03: S   SQ 4(0ttttttz%%y@@TM? (0 ,Z , KP,0 ,00 0S8( b, ,0P08#80 uz -L -L p-L@PT`PPU0  l0!^ !A;K0 l0! !ю;p 0-L@RL 1R a1R :R= Zp@00,00? 400C40J <"Z 0, -p- L@`,0(=  3 03 HPF!@(13S 0 0]Lv"@u @0_! (13S P_,00,0duup --P`,0 L -0(00303$l00 0@F,00,0p 0A]Lv"@up -p- L `@(P~F[ 0v_Lv"up -(AL0LS $$ 005 0T0 0CL0uu p-P,0L=(03Sa@T,1P e@T,@$U?P Z@T@e?P Q@T$P Jp -LpPM`\T=;, P00,00,0 (BP000 BP0<0 BP ,PV 0SS APO ^AP000 APP$,P 0SplAP0`000 ,LAP0P0 00 ,,AP000@00 ,rAP AP000AP000 AP000AP AP000ylAPP,P 0SD,,K vB,0Sd .~APP,P 0S,K _B,0SM gAPP2,P 0SW^B,K FB,0S4 xK^6|x@vDvLvTv\vdvvvvvvvvww$w,w4wP,114p\: 1 \:dd \:\:@D \:10S : 0 lzzzzP p` V: -L p`@F ;pP ;p ; ;p046Q/XWp -LP(1,`0!`#20#Pp"p3W  0 P0  -L @\`M⸀(4000 KK4 ^ 01 SP U[0K* K,0KmφA,P  P(\ U P 0H=8 0i=@0 8 8P\40p(q#2R0  40S \L0S \0Sd0S`0S P\(!`0@  0 ,0 d0@   \\0 !(10 000 2 00 0S) PY p P\s0@E<8 <@ 8P<o\\40p(q#1R e\RL0S00u0C0 % T0R00BRO\< ;Q <0 0 @ 1$01(PQ<01<2[BA$S 2[# {H{Sl{{{4|||||}D}512[S51#= ,!8#8SA(A$A"A!A!8#8S@(@$@"@!0 3@R 40S [0\ 4 R [ R [ !\| [Qd[QP[0 c @< @ <P,[@T 8 X 00001SPU00P PU0f|[p@TPXx[X@!@TM?PPU?P]?Pe?P 0APP @K@P 1@ 0JBP4 3: S`0S D0 00 4P ?d0407[T4[,  !Sl}}}~,~X~~~~2K~ @T,1P 2@T,Y ) - 00@00$L00<" -D00@00$LI/~$0 00<" -@,0L(3 08#8, 30 ,0 00<" p-L@n?PM0 K1Ko?0 K1K$0K0,(0K00K$ ( P7 ( $0[[,  10(QQ( Q 3#=  80#0,0d0` o  Z<"D=#  sP,00,0zp -LP1`p 1(!W *H@R@ 1pW:1 !0Ⓜ(p00 00(100h0 (100c0(10P0305(100U0$0S -00LM?z' -L0M' -L:00 $0 X -@@0LS|AfB# 0-@0L1P0  b2b217c! bB! 5 R $0S(0S 50  b2b217c! bB! H5ǧ0P" p-L@`0P0  b2b217c! b0B!6"d5 R $0S(0S x50  b2b217c! bB! Gc5`5pP" - `Lp&&Z F  D0RD0Q p-LP`H@P, =?0S0L0V5@6l@! !& B!^ !A&K0@ST<@ @P  ^P 00 OO&5 0LX0@U p-L M@0`PP H0 VP P#80<B+/p -LP`M0@P6 p 0<$KpP,$-H0? 0H0$41<0$D1 @0$0,0$000$040$ @P  4P$#80<A<" -Lp`* M0IcPP6 < @ >@P .  H0HaP#=?04!< D1 @00,0000040 PP  w4 UP#80<O<" -L` MP0 p0W/@P* 4: S%H0! 0S&`000VP`VP#80<p`]a -L`P M pP= (<@"(@P 5 *H0 R R0H0G4000  0pP#=?04!< D1| @00,0000040 PP  3 P#80<p <" p-L@P`0P  0 pp -L@P  0-LP@P# 0 PPP   ( C(@; 0h hh 000  PP 3P40,,LU =0$NsNLz" , -LPLML P X   H@K T0 'm?`T  PD` R8@K0SX00 000,p;C8P P>>0S OCP 0S EC?PP(\  p 000000 00@4: S S000 0 +t " ?`K Stdd ?b 00R40T0pKX0 0S R0# ` PPPU` 0VU`P 0L  003SL 'P7pL P0 0eL P0 0S Q0P SR' 00P`0VU`P0X0 =?0 0L  003d S 000 bL 'P /p`Pp KX0PU`S! p000S 0T  @TH0p彳\ R 0!(0\0a(0!T0 Pz"T  -L`Pp M ^@9 1^ <0^9=?0 0  003S0 K 0  ('\- , R=?00 B|0PR00P  =?0R$p 0S  d@d@d p-0@0LSp` P$PPP PP { P8 PP=V 0@0`TpPz" -`L0pS\M iK= lPKPPd ?-,@KX0P 00m1 p0K00pXz"\dTz"h -LP`UMp*@K  I1p000 0 0 $PU: -LH H0@@f$\ 0 10 PP -LQP <<00#00 IPPp -LqqP!^ !A"K0S ! !"@T `$PU3$@T(@P 00! !"(b% P00! !"Ⴒ0000S@0 10! !ѧ"۰ 0$@@! !і"۰ Qhz"Q\z" p-L!HE PQaQa$$0!^ !A^"K\" 0S0 1 00! !\"R^ dd5Ip$\! !G"K "IpQhz"Q\z"І -@0LS 00 000p!^ !A"K0S& 0S``ʬPP ! ! " Q I#寬 PVb10 $ ` #00C00 10! !! p-L@PQ$`!^ !A!K 0  000! !ѷ!R  Hp@ 0-LP@S S @ 00 0 0 T0U 0< 0(0000X0QP0;" -L` M p0 RP\Z  0R tF00  0 EH0 0A p L@ t00RX =  ("( =C 0T# 0S  J %d#֑$@ -L0 M<0 , 4 0 8 0( 0tG#8 004 0  p00S   R 000 %<0S< < :,880 00 @@$@p00 @P[00 0$0 00G %܈ -Lp\M0PPKx 3`PC(C#t@K$?# 0Pp @ K@01X00 0S%30 0|zG00@`0 XpG0-<# [p\@K01O #0 p ` b2b217c! b0B!61 00 0AG 0R0 0R 0pSph9  pQ@@ T 20 GT㻺00 010  G꯺@ t  0R0069|0 F1`V0 R0 0R 0R`\X  1R Dp0 0FpP @N 0Ap  L$p| 0 P b2b217c! b0B!6  pQ @ %8܇ P"tJ @ T00@Tx x@$00*"0 uF`00 0TV x Z`P 0 0S $PV`T -L -LPpM 0`@V'U0 "1 0 c0R=0s P01H 0b?S0 H0" 00b?Stq9P 10k  0< < Fe 0U0 !1 0 c0R=0s P01H 0b?S# 0  3!: S ,1$10c C!0!0 0bS=0s P$!=0<hpK 0ԠK 0POD r)P =[   X000H0(3 : S 0,1<" %x0$10c C!V 3: SF ,Pj, 00   -L@L00 0<< <0nE0P0,0 % -L0@ 8P 666 -L`@M00 0< <AE0@ 01#PR <`pK0 L00`K0Pu U P o P ,t-P00H0 %ĉQ<" -L` p@0PS 0  0<0 0pP  B P ],@00pH0 00000  <" p-LP@`M|00 p( <0D0cK@0 <@ K0`KPK`P(P %؉ 00000  p -LP@`pM00 t( <0D0dKD0 N <D K8#8`KPK`PPP n % 00000   p-LP@`M|00 p( <0dD0@0 93K <@ K`K0PKPDP 9 % 00000  p 0-L@PL00 @( <01D01<HP040 %  -Lp@MM`h0 \< 0<D0SL 0S0 0< <D0P@ (0+( @ 0*0 < C  Pu0S4` &0 <0 40K8PH00H0:,g( %8\tz"<" -L@p P`10 << C Q 00  0Sڼ< 0<C!0p@U 3 : S 0,10$10c C!01<,pPU400C40+X + %؊<" 0-L@PX00 L( <0SC, Pr  P00H00 %<" -L`PpM00 p( <00C01#@TJKQ&P90S 0< <C^<4K0H0 q @& <A/KH0K`K@K`@@P  % @x< 0< <B 00000  h p-L`MP@00 0< << 0`<0B 00000  $ 3 : S0,1 %<"0$10c C!01< !s?R!m?R (>, %܍ -LP  0-L@PP '0 <!8僧0 -LP  p-L`0P@KlM0 P  a>4p -Lp`YPM ` V= l@KD R R3b>0S\q0S`q0S jK @ (0 K0(0L0|Kx0S  (3(  00 `  P 3: P # 0B00QS R0A 01 0!0S , P 3: P # 0B R0A 01 0! 0 P 3: P # 0B R0A 01 0! 20(0  0@0<0H0D0,00,0<0111$0@0111(0D0111,0H0\@11100\140 P8  @0  0 H0  0 P0  0 X0  0 (0 000@S=x0@0K( 0~0K40@1 00 S P 0n00 8[S (KP  KpP? (0  ꐎ\iiRHWVp`    8\#0P  (0 00S   (00S   (0#50S   ~PpP(0 0(0/W $ R4 2L00 KTPh.=40S040,0S P 3: P # 0B R0A 01 0! 00S P 3: P # 0B R0A 01 0! 0(K 0(C0 0 S01@ 0 Q0PK0 Q0P`1S 0A00RS  Q0B  02 00S   0 S 0 S 0>0#6 S0 006 00>0#6 S0 0060 P* 8SQȎ P # 0B R0A 01 0! R :00 S 40S S040K  0 R Pc<  dd p0 +:'pR<5-\L<6LG<$<B<8 $;<  Hh/< -L@p KhM40`0OT1P0@?0K 0C0 0@\P0A 01 @K [T0KB@DPL0K [xD0K  [q<  ,0Q 0 40Q40 0 0$0 ii a;00 000  -L0@0 >< :< 6<$ KR 1"-<( |QR h1h"#<, \1R @1H"<0 R 1("< q0S#  0 `P  0S :`P  0S*  00 0 0SP  0S* \  00 0 8< ;阐QpȐ ؐLS 0-P3L: S0(10 1L@101k@3: S0,10$10c0C10<" 0-L@S.S0 p-L@`3PS L0M/ 2  Q3t0t 0   Qd0d 0  QT00 @ GOD X0 Zp(RQxRxQ0QV 0-L@MϠL 0Q 0 0R 0OD PPn.P,0S 3, : S 0,10$10c C!0<" -LpMP`P<00 L, 0< <@:  % -LM00 K4 0 , 8 3 $0 S:- L 80 @&*@P 1@ 0 R 8)T 4 F@00 M?,( W: S:,& %Pp -LpM`威!0 0bS0p=0@s@@T T.:_3: S000O 0P@@兆TK0K1  @PB0 ; K 0 @@R 0R 00P90jz8[f? K> Kb?x K8[08K3 : S0,1<"0$10c0C18[K=@ -LP`M,M0 pW 0!,00,0! 0- PK 0T  =?0㰀8@K8 40 0-? 000=0 0S+0T0 =?0 01 T0 M?@㰀HpKH D@ 0000=0 +0000M*  -LD 1 0 c0R=0s 2<" 0-LP@001\  0!000!Q -0 -LQ\P  0R H7P J -Ls`@pM━0 M? 9Tw ,Ps=  0400Tj .`Pc 1!0 0bS9=0}0000PK1`P 0 M?` 8tv50 00400T- )*8[ 2`V 0 M?`4 8=0`s` %<"@0 M?L 8008#80͠0 08#80+| -L pM4 T30 D( ,0}8ML 0R 0R  i83 :* S00\0`Z0@K0KT0!0@  `Rd0b?Q RQ 4 1R0 1R00Sf? 0 R0 S 4 .0S00S  4 0 f 0R0 0R A  0R0 04@R@4@ !s?R D 0,SD00S0Kd0b/L0 T0R0S !`0P0f?0 KD023$040(080,0<00 80`P` ;D Rq:00` 0 %В<"<0`080\03@D: S S4P 3: S0(!0 !0!01Vk7%i 0 0bS1 !: S0,1R 0$1R: S0,10$1101L0 0cSL<"(# 0Y71( -L`< 4 <( "4,<0<4<("4!< 0<4<("4!<$0<4<("4!<(0<4<("4!<,00<4<("4!<@<4<("4!<80<4<("4!<@0<4<("4!<<0D<4<("4!<@L<4<("4!<@P<4<,4.<@pT< 4 < 4,< @0P< 4 < 4,<@\P< 4 < 4,< @0P< 4 < 4,<@d< 4 < 4,< @0P 0R00 @0s00 0 @ :: 0 -0Lc4 0-L@P 0 PPcP4P0 p-LP`@ P 0 <4<00 0 0,$,!$#<00 0 0,$,!$#<00 0 0,$,!$#<000 <4<("4!<000000 <4<("4!<000000 0c040p p-LP`@ j 00c040p -L` p MX0 P0Q <4<("4$<0<4<("4%< 000 0c040,8P 0 -Lp08`,$,!$#L ` _@<4<("4 !\R 00   6  40 S00S000 @cR*5 00  t5dh0@dU HPu500,00  (l50UP5l %ؓ -Lp`  P <4<("4$<00<4<("4%< 0000c00 0x p-LP`@   P0 <4<0 00 0,$,!$#<00 0 0,$,!$#<00 0 0,$,!$#<000 <4<("4!<000000 <4<("4!<000000 0c040p p-L`P@   P   00c040p p-L`P@  P  |00c040p p-LP`@  h  eP0 <4<0 00 0,$,!$#<00 0 0,$,!$#<00 0 0,$,!$#<000 <4<("4!<000000 <4<("4!<000000 0c040p -LP` MX0@$0p$1@l <4<("4$<0<4<("4!<000c040,8@@0 ; -L`08@,$,!$#  `80 PcR*l3 X10  L3eE0 00p0 c2b217c! b0B!6Ah 0 ePS 0S<4<("4!000Q0S @0pSW0S0S W000,y300t34 %pP"ؔ -L0S0S 0 0<4<("4!<@<4<("4!<0@00<4<("4!@0 . % -L`O?4@K,M40 :00 H0KH ,0 (PK`p0 T.DK0 00 P@0 n. %̗ -LXM `| OX p&ZF`TKpXK P@H` `D 0 LP @K0x0 @0Kt0 X0Kp0 x0KX` TP P l@ h@Kh0 X0 0.밐| 0 ģ@0 ".P 0  % -LPM `t O` p&ZF`\Kp`KP @PL` H x0 T DK 0p0 D0K`P X \ l0 `0Kh0 p0Kd@ T@K`|0 l0 -x0`t0B  o@0 (-T  00 %0 -LO?(MDPKD0 8 @ < 4@K` LpK`L H0 `0 T-0 00 @ Kb? K9[09K9[  ;TT  %P` 0p D  0phpVD0U`^0 P Q % -LpM, }@tZ6$0S ,0!0!000!$ H0Pv%PH,0 00R  z,; ,P !J6 DP` Q,`D0P ( -M0 LP 0D0 $Ơj JR:D0PJ$J0TR* 1 S:,0  1 Y  0@PPP 0@PPP sY  0-0L1 0(0 0@#*<0@@P 0\ =?0 (3R,0 - R40S 00S<0Q80P0\0 -Ls D00D0 R (0 0Q:  -LpR0Cso@ SH0 D00D0qP#U@T (0 0S* -L0H@ mP0 10`1 -L0H@ JP0 10`1 p-L@o_k`!1 f!R  S00R X$ph 0-LP@ 7PP 0 @0qI1P0e10 0-LP@ PP 0 @0q31P0e10 p-L@q_&`!1 f!R  S00R $p阝 -Lp` M  , s_ D0@0D0 R (0 0Q: @T H000 P PnUVs fpV@ H0( S @H0L#1S  R (0 0S*1010`0 `D00D0 @ob101 R00 0Q? 0 mlW\P  `1R !0 0 0`vW p 0!000!oP 00]=0080j00}?80e0<< S(0 S 0R 0  o?RP Z,0 S*H0PLI#P0Y,0 00R  M ܜJ<"( Z0j0<5@05, R<00c@0 -0!L 1R!R : 0R: 0 -L`PP\`V  0R (!0 p0@P 0S$0S(0S  0PrZ J -LpM,   0 0 0  Ơ!ZF@P < <0"00 1 S:,00 1 ,00k`PyW Vzr ,00Pu``v  0 0`P``VVJ ` !J6 0 pD Q0D0P☐尐0 L -L@"@pP1 M0P!߉`P V~K?,10M?0V @T@YU 1S0000P  0٭0YP`L00080 040 000 0,0 t00 M?d0#0 ! @@K8K ㇗B  Iz"$ y %$@0`DSppW 80Pu!P 0 0@@p @o101 R00 0Q? 0 ' H0@PO!@H_,0 00R  S0S L( -Lp`,0K@ P0 KM0S ,@K NP,0 8PZBD@0PDSX 80` !` 0 0@@ @o101 R00 0Q? 0  H0@P @H,0 00R  a0S L( - MPL, P0 Ts0 H 0!s000ז}㉧0SI00, 0R*0SbB0 0bS 0u<000000, 0 Q*0Sb|B0 0bS 0  0\4 0| 0u<0000000S f> b? 0000  ,1K4 S ,A0pDS``V 80PL P 0 0@@`(P!0 0@K@&#j VMO <  0@ @K * 0SE@7 R0T00S# H0  0 @ 0pp! B!R  1s_S00R l1SW0p 4l %\z"<"z"L8,0S0 0S10S# H0 0 @ 0pp! B!R  1s_S00R D1S;0, )8 % L00 @0q}?80N101 R00 0S? 0 Y p0 dH0@T{@H,0 00R  ,14S<" %((  -LK\  ,1,0 ,1pC(00 0L@#j(V 0@#*<0<@ @PH0P SD0S0Q0Qp$ O?00 00>0 -L@!@0MPP VK?,10M?0Ut @T@,100 `00PPL0000 0,0 0(0 0$0 \00 P8@K/0K ͔ሦPIz"d y %<@0PDSppW 80`` 0 0@@p @qb101 R00 0S? 0 m H0@P@H,0 00R  0S L( -MPL@P30  o0!s0 00劔 }<0S00S f> b? 0000  ,1K, S ,A0DSPPU 80`$6` 0 0@@P!0  (0@P 0 K0 00Ġ p /@0 4T9[K@ %p -LO?`pKP@KⴠKM0 ` p ` X 0 LiK0003: S 000 00 %0 00 0 000K000CY  @ 圠 09[P 94 0 (U 00S P % -L`O?@KM0 :0 0K 0 PK|p0 pK0 K0 PPK0 8[@ 0  %Ƞܠ -LXM `| OX p&ZF`TKpXK P@H` `D 0 LP @K0x0 @0Kt0 X0Kp0 x0KX` TP P l@ h@Kh0 X0 K밐| 0 M@0 =P 0  % -LLM `DKt O` p&ZF`\Kp`KPL` `T P H @0p0 D0Kl0 `0K` \@ X h0 p0KdP T@K|P0 l0 B  t00040 @0 XT %$ -LK`pM @Oϊ  p @ @ FKPK0K0 0K ̀K̐0 p  = ?0| 00  K0``0 iK00 P`9[@ K80T 0S :S00 ` %@<"'0 xT$`V!0K@   0 \e @0K0K 00 `0 @a@0 QXp -L`O?M pK0 0K 0KP 0 0K p P @Kh0 \ *0XK -8[@ 0  %ԡ p-L@xP`XP 0O?0000 0 0 00 p p -@0LS 0 Wǂ -LK`OP@EM0  0@0B?P%`&0,$,!$#,<4< ("4!< 0 000@00S <4<("4!<0 < 4 <( "4*<00 0c040,08,0 7 -Lp8P0(S<4<"4!L T ` R 00 000 `cR* 10  f'0 00 c2b217c! bB!h0 @0fP0S4 0S;<4<("4!000Q:0S \(0S T\"0S \0,$,!$#@Q000S @0SX0S0S X0008>00(9 6h %P"< ܣ -LM0 S0S  0 0} < 4 < 4,<@ < 4 < 4,<@0,$,8#$!,00 0 B<4<("4!<@`P<4<("4!< pp0! "0S* 0 S K#0S KDs<4<("4!<(R P=KK-[=[ 0 0 S0 S   -Lp`@ <4<0  000<4<,4!<0`<4<("4$<0 `<4<("4!<000c040 -L -L0,$,!$#L 2` -LP0` #| !p`0SK < 4 < 4,<@ < 4 < 4,<@0P< 4 < 4,<@ P< 4 < 4,< @0P< 4 < 4,<@< 4 < 4,< @00000S = -L@0p #l ``#PD}<4<("4!<(R0  &0X 0 @Q 0S @0S  0-LP0(S<4<"4 L0 T 0,$,!$#, 0h`0 -LP@M`X ppG <4<0  80@ 0 0@@c@4@@,0p ᭯ p-L`8P0( S< 4 <"4,L T !`p80 @cR 00  0dಱ0 x00 c2b217c! bB!ƌ<4<("4 !<S0!0p %`P" -L`8p0( S<4<"4!L LT `<4<("4!<0<4<("4 \<4<("4!<S 80 @cR*| h00  \d@h0@dU 0P000UP5阤̤ %8 -Lp`P0(S<4<"4!K < 4 < 4,<@ < 4 < 4,<@0P< 4 < 4,<@ P< 4 < 4,< @0P< 4 < 4,<@< 4 < 4,< @00000S X<4<("4!<0<4<("4 !<0 00 00 ` -L@0` #|40S$ PD<4<("4!<(R0  g0!0 @Q 0S H@D0S =0@pp`P0`SK < 4 < 4,<@ < 4 < 4,<@0P< 4 < 4,<@ P< 4 < 4,< @0P< 4 < 4,<@< 4 < 4,< @00000S  -LP0 #| Yp`0`SK < 4 < 4,<@ < 4 < 4,<@0P< 4 < 4,<@ P< 4 < 4,< @0P< 4 < 4,<@< 4 < 4,< @00000S uP0`SK < 4 < 4,<@ < 4 < 4,<@0P< 4 < 4,<@ P< 4 < 4,< @0P< 4 < 4,<@< 4 < 4,< @00000S  -L@0` #| p`0S @P0`SK < 4 < 4,<@ < 4 < 4,<@0P< 4 < 4,<@ P< 4 < 4,< @0P< 4 < 4,<@< 4 < 4,< @00000S  -L`lM0(S<4<"4!| K`WP,< 4 < 4,<@ < 4 < 4,<@0`P4< 4 < 4,<@ < 4 < 4,<@0`P<< 4 < 4,<@ < 4 < 4,<@0`PD< 4 < 4,<@ < 4 < 4,<@0`LP< 4 < 4,<@ < 4 < 4,<@0`TP< 4 < 4,<@ <4<,4.<@0` p-LlMP0(S<4<"4!l KVP<4<("4!<0<4<("4!<0<4<("4!<0<4<("4!< 0<4<("4!<0<4<("4!<0<4<("4!<0P< 4 < 4,<@ <4<,4.<@0`p 0-LlMP0( S<4<"4!L K}T<4<("4!<\0<4<("4!<`0`0 -L`P0(S<4<"4!|K < 4 < 4,<@ < 4 < 4,<@0P< 4 < 4,<@ P< 4 < 4,< @0P< 4 < 4,<@< 4 < 4,< @00000S W 00 00` -L`0@K M4` 0 @0 <0K000(0 d@d0DPKPD0 Hp@0S SD00=?00SP(00 z" H0WP ab ꨧ 0-0LQ& T@0 PR0 0R00 0R8 0R80  0R-0- S RPUQQ @@ 700z" -\L\ L(00000 40R\0SX00X0\7ii -@8 L00#S  S8 L0S+ 080H0 Lh 0H000 t 080H0 Lh 0H0000 $ B+ %ԧL 0-LPM?@  0Q A(00000 0R\0S X0  0X00SQ<80 080X0@T 0S 00@T07iiz" 0-L@PT4D H0,0L u?|0x LKPqP ||PL 0%  -L|0uS .r -LM@oK10S  |< $0,P$ 0S P$@ 0 0 0S   0 000S   0 0#10S   0!}?p XX?%K XX-0S0 /0083? 0 000!`P @\ 00!"] P A0000 0 00 (004D O2u/0,@,0P | L  XX XX-0S  X00X00k@ @ XX  6@Z~"% @T0 qq0!-? %K??8H3 0000!$00 s y %@ 0-]?P0LS"p@P " ]0$T}00P0S 0` -L`pMP@‡0 h 7T4` 0p , \Q  <1R N( ]t@T(@ 80 0S< kP, 4K }@P00 d ntot t 3kt @-=?00S'$Q 0 L0S <$00  %Jԩ $<=?00S @ -L@`MPp\00 D P 4K 0(0 04` 0 ,p @r} %D$ -LPpM< `@t00 \ P$ T8 4p 0 \Q  0R ,  %DJ,@ ] 8KP<0 7}@Pr 0-L@PP P0-0P 0]0 -\L5 -@\LP K0\0 -L`P@80p P/$P$0S $ P$0S0S$0S H0, ,T0X0\PD H0X0$Al 4 -L@ᑏK""MqK#K!K0@@_KD2 0oK00 00 (0<2 0!KD OC=?0pKll| 0 PL "00} PP 1$Z~"%  -X0L0X00@ @ \P$Q Q $ Ъ 0-L@PP7  Rh00 \bQ}X Q 0{Xo0?|0 % -L@ M, 0!}?pΏ00 /0834  40 000 !`P @ P@@000000 0 00 , (004D Ou/0,@,0P | 5L,|p ~@Po0!004H3 8 0 000 !Z~"% H  p-L@7PP #Q00! `0 (Q Q Q0 LDnp{ᦌp %Dl -L Q  8$"sJ $ -L0   -L!1  -LPXUM~|0 U 0,$,!$# @ 0iX20@$"!^ !AaK0 0bSqa@T/ Y 3 S&Z 00 S!X 0S   0R  R 0Q0000@@!! !@n@TU^ 0 pam@PS p 8#".,.80.Ġ P 03T0T0 0崓  \ \ `000< 0H]=00h00@S0 u<00 H %t Z<"|"{"|"= 0l00< P0<@000HL000@0@S000,! !|" Z -L`Mh0 0X("#Tp!^ !AKPU @101h 00bS+0]-0 h 0# av @P* 0 㹆 00xPP> 0H 0 0000P! !l %ȭ8 <"d|"pa0A! !W -L@T00 H)Q 4h 00bS070]=00h0 %4<" -L@P P00 D P08 0P00, @S u,0 »- l  %L|"<" -L@P P0S $00 P00CP0 %` -8a0LM $ q!^ !AK0 P耟AT 0l0@TPU5! !۔@0S' 0 xPAT 0 PP 80l00@TPU %x Z{"|" -p0L `|`XAT 80080@T`Vڐ `1@pT2 P0S800l 00bSp!0 S0080 0S PU 0S C 00 0Oxlh 00C0@T`V@00@S(00- ]-0 0  % {"<"@X|"|" -d0LP T@@n011,00"c10 00p|"TZ<"`|" -` LM?@|0"02! ! 00!/<83<08#H3 00000!X0 LH"0S 0004"1110O0AS 00!(00!10S q0S@  q00 q@@T)QJ0 0p("#HQA0S 0 0S 100cS@ n0S 00S=?00S 0? |0R |@ R =?0|0S t00S i00`aFTCL Oؓ빍l|"4Z %TZd|"\|"`|"ذ<"h|"HZ -L`X=?0 0  003S3-K8Kp0x S 07[1;Kl0p S 06[1;Kh0S06[1;K6[;K6[8;K=?0 0  003h S K ሻ P UO Z`K&  ZGX@=?0 0  003S OK K@ rqq"rr"OKǺT08!440 0 , dVbK#8@=?0 0  003S]K &@]K᩺T 8V00 8V,0 8V2K6VSL16V40 P mkhQ!^ !A߷K80<0c 0EP@(0A`TH `F8 0RB?4! 0*`R 0R 160 <0 R/ xP) P)04 0R140 <0 R 40X00000,00"[1++<010 $0L꤀"q<"`! !і -L BRĘ ̘ ܘ 0S 0S0S -L`M 80 ZϠ\ VrP@ T pw  R<0Vx@ 0FPPT!(0Q@U *@<0V 77<0 S@P(00 0S,00S880 @yM?@0,@ 0L0 4K40 0 2 0< FP Pt (0Q*@U^ 4 R 000 040 00S @P0p|0800 0 0&q"=?0D`|0D400V0 @ `LP  0 0000 0R00V0S<0 p0 p(0, 0 (0, \ 0!0 00!@ 0!000!@pW "<"rr -LpY,MP0 0?SH PQ L  P0L 0cP0   00L0 <0W0GPl"(0X*@?T0 8 0R@I7P<@`@<0T PPL P LQ0S`0CP0 `VC P 0Y*  @   0 0,0p!0C,00? 0|080(0 0b(0 @!0!00`0 !$!0!00C0!L:H 0Y!KPH0 P  G )@Bm D0  DKD0 @ P0L?`<` 40 8 100 0  0,0 00T $80<0 cQ0ꔀ"<"rrd (01S,Ppu@ t w00@ D0 0 0D0 0RM @ꔀ" -L p` 8M, 00 !^ !AKP@ P0@Z=<0U$''0'ER꤀""(0\& 0 (,4 8  $ 7($,Z@X@0 0X0PU0 T0! !U0j@c0 0T@, T0 " -L`Q p开0 0SɆ18P@P  U ặt  r 000<180$0(0,04`000 0" r"<" -L@`pQ 10X !^ ! AٴKV @JPu @"  @< S@ <0U0EP@(0AT@40X@AP @0G! ! ѹ rЀ" -Lo @`lP8#x T(0\*\8 0R40SA_P " -L@ႁ TP*$pa0^0Q0S/-J ^)0  000a9S*0\:0S 0$ !0   00b0L\*`000!0  L\ : L$!0\0`0*<" p-`M(@LT% 0S  $ 0(PP/U(0S00 0P0 R000,000@Tp 0-L@(!X\ $ ^ !0 S0S0 @^\0 0-L@(!X\ $ ^ !0 S0S0 @^\0 0-LOP0 R 00 R(@T *00+00@T4 080b0a0"" p-LP@R,M  R#@=?0 0  003SD`K3,1K=?0 0  003$ ,S4 0  ᖶ p -L@T`hMN T NTLLK(!}<@0 L0 Q  040 ,P H D < 8 !!^ !A#KTl1 00 (0 000 (P L1 @! !$(=?0 0  003SLK @\ 9T5@0V/pK@㕵<0V0FPP(0QU IP@G0h0 0`0 40X0  JP  rЀ"""  -L⊯K_ `pMpl2 P`(0aV *@80 4PR@GQIPp  W W W.  Up څZP  I?@P40pP*$ 10040P:=?0 0  003S  ᦵ\@ @ Uڅ-P  @=?0 0  003S  k@T T @P00SaP  0@PuP0$ 01P0Q P P 0Q00@ 0TOK@㳴0D2 0<2 4042 l"}P F@X0?S9$0 0GS3 ܮ  , @+@)!@#!@!@"<"!@ P*0Q 0 Q=@ ?0|000@ 0/KZ <" p-L`VPxM<S  S4@@=?0 0  003SdK ᷵@dK:T5[\ 1K`0,@=?0 0  003SK ៵@K"T 8[([1K8[ $0 P CϠ80<0 cQ(0P4 8 0R*.-? 4 0Q 0Q 160<0Q V V $080 00![1++<010 0"<"p -Lp`PPM$ @$Kc$ 0R9ꤲ |        | | !6d@!^ !AK$ 6p! !Ѐ" -L@=?0d?P T@@@0P ` -L`4p0P?@P  U P  XI?0PP -? 0 0d2000dB00@@i@ -L0 -LP㊯K Y / R@Ml h p t d2 K30YG@Y?P ? ap]?P 0  003S  xpV WdQ/ @ 0  003S_K a@T P \Q R2RP2Q!t" & d2?B c111t2 80<4Ÿ0x cPp(0qPW x"PE8 0RP Z* 40R*0  h2l0Rh2 p2Rl 0Pp2 : PplIp Ph"R =?0d2S`2 `0s` 0`2 `2S 0S`2S &Kp2 PPh2`2 M?@  `2|``:PPz`2| pl@T=?0 d""<" -L p(M, t`00 嚼@d !^ !AK0 PY5<0U$''0'ERЀ""(0\ 0 4 7 b@X@0 0X0PU0 T0! !]0i@c0 0T@, T0Ѐ" -8000L( \<0R0BQ(0Q(0-0? ,0$0| 0$0< "<" -@DD( 0. "6C0 LWi="" -800L0@( !^ !AKR<00BP0D(0P=?0|0X <0$0 0CS$00 1  ! !ܭ"<" 0-P0L@ot00000( d<0R0BQ(0Q00-0? ,0$0| 0$0< 0pr"<" -L>0X#6M< @0  ,10XS1@ 0 RJ*\<PP D 8@K s [@t``Vp1@0  p& -<? <1|0p <`0`,`800 ($`p' 400<0( 0@ 00 r" r<$r"<"(ri = -LP@p`!^ ! AKT +JYPu !  q< S <0U0EP@(0AT@(0S:AP 0! ! " -L@0 00 \"<0\|''0'LR0(01S 00 0 000!000\0\" -LpW0?S`ZM #cK1S  0 X P L L L L L L L D D X t T@K$/X3#3 0P0 H L D T   X+$=?0 0  003S ᫯ P10h =?0 0  003P LHDSd ` \ X hK ᏯPt2PUpKB!^ !A4KxKPD0tK0 Mt2P 0p0 l0 | ! !6=?0 0  003S R\ UԠK T㭮Ϡ80<0 cP@(0ATj 1 S0PWq0w8 0R*PPgp PIP` (00 ,00 000 400 800 <00 $00 X  X0T=?0 0  003S   ! AK9[>K9[>K8[0>K=?0 0  003 S AK ݮP $r rr"""-? 190<0Q Ϡ800X p0!T0ST `0!0S V @0!-000H! -`M`0L,0 YU XpW \!^ ! ANKP{4ATPQ x Q;0 8L0 40111!0 R @0!T0ST `0!`0@\@! !ѵ̹!^ !AK0S M?@00P P00P000 0C"00 0S @@0S P  -Lq!^ !AaK1a4 A\`!^ !ASZK 0S,A>X0P S0P0 P ! !V@,TPU)h/PT h٢T0P PPT000T0\ \P`000X T00T <I P00CP0! !( @! !|r| -LPK? 1``@cp1TP }@t9pSj wIX0P 0& R000X0!P0 R<0 R0 R;R09T0P`P P0 p0CP0\0! !̟FP0SpPpWP0SX0P0 1S,00E-? T040T080\0! !єQ 0!00C0! 0000 -`0L8 0R 0S -L`b(M40!1X@Tk @p 0lA\0PSW`0p@0 ,0,4 PR %P< R P@ R P8 R P0<0K;0KT0 <Kݨ  <KبT0 <KҨ  <Kͨ@ p<KȨ `<Kè<0[S 0<0K<@KDỨ  (08< -Lp` 0M, \P@, T0#03X0S  Y@ 0RR@, T0#03Z0S0 V f P 0h, 00d@ -X`000LS  -L`\pX@!^ !ArKT6 HQ !p0R101T0S' 0S$`P00! 00!=?0 AP =?0 (! !H -L`\pXP!^ !AKU/ H0S !p0RH 101T0S 0S`@$00!T00!! ! -X`0L40 S   - LX0 S \0 S  Q Q Q <  p-LP@0`St0S0SB P0 ` 0\0D\0S3 p 0S S S x {|twl@ dp@0!`0!H0S !p0R pht -L@T`XPV P \p!^ !AHKT\0S `0<V\ <p-! !G -LM40S00, @1`f,P4 ,0!c11  T2T00000012101, AQaq!00 0$ @0,04 c1!D 0P0 0T0$0dX01`01|01010101 01 \hl@pPt`xp0000100H0, `V$p4P@,0,0 0020010C\00C`0d0d0 h@@@tp,0`V @P @P T4W,TĊ"<  x t P | X @  -@ L  43,040 -Lp@P1 0Spp,0P#)1`14 ܀a!^ !A7KX0SpXP00H0T0 0s(0p  (0p  PP 00H0Pp `! !$ 8"|rA, -L`Pp04!c1q0 0S00XQ  @!^ !AKp (0p (0pwX! ! 8"|r - 0LR0S S S 0S 0Rx x0R 0S -LP@,0pT`400XP4t`,0@T,@ T40X \0S0SP0S t@ T,@T  40X0\0SP0S t @T -L`PPq!^ !AKK@P; T0P S 000SR /X \0S'00X 00X l0l0X d0d0X 0 0X 00X 00X P0P0400c#c!'b21X C1p0X t0t0X VX0p! !|r 0-LP Q,0Rp01b14X@!^ !AK! !0|r -LP 㿑霆" -LPƑ霆" -LԝP 㧑霆" -L՝P㮑霆" -(0( LP?"` )0`Crr -00LS*0 @ 0|! Rx1 |!t!x1t!T0|! Rx1 |!t!x1t!$00 0锆"`dx - 0L鐆" -!0L   -!0L  0S00鐆" -L0 R ?L"0%l00  `0SL 0HH0 0S@40P  鐆"`x"rr" -L`PpQ =?0 0  003S@T&W 0  xx0  R dR?AP0 000S0?A"0%0S @Trr" -LPP00S < S?BP 00S0?B"0%rr" -L` -L$$$0$ 0S r""r -LQ 1 0Rc 100S S  S @0@P@p@@0@ 0@ 0 !@ R& R R R  R R R  R R 0R 0R KK  KKTT00#`DD 000@0000@0tpl -L@ -LG -LdpP`\00 M?@0SU 00bS=?0 <"x -K?M 1LR9䀟!^ !ASK @T*Ip0PU @`0}@P  p0@u@P ᢑT000! !Řr""( "  0-LP!^ !AKl 0@CT@ }D0@ol! !ѓ0r"" 0-LP@Q*P00 D0 0 S(00  00Q:0x` -L -L0 R 0$00 -L0 R00$0 0-L@0P  0 0-L@P @  P 0 -L@00   0p0 `  P PUPPEuPyPu U } y u q mx -L` @@a ] Ysp o k0 @fWX RTPT TT 0\04: 7$PP@ @) %p  WW WW㲊 0\0=@P 0\00\0 -Lp0\0` `PZ P@ @UZT0\0 -L@ \P0\0  PX `  p/  & P  0%  ~O`  0\08d0 |! xe` o k! gTP ^VU0\0 -`0LSt0S0S 0!P0I3p >+P P5"@ @,TUc0PP0@  @ TI     pW    0\00\0  \x0 !00Q 0     ! -L`@P0 0>`4  0q00 pP P0    urol xT7P o kP04U00l01 0-L@0P 00 S\ 0U0 R0S 000 T0 0-L@0P00 7U \0 S000 :0 -L0 0 0  -0L00  -L`P0@|1qSX|1Sot1x!00,00,006  00P @00@0 <00<040040080080 0H0!p0S000000x!0x!0 x!00 0x1|!0x1t1 |!0t10 |1 S x!00x1|!0x1t1 |!0t1 0HS  p-LP Q@  00 000p R 0-0 p ` 0 j00;#;000000 R `FV0c;#;SZ Rp 0-L@8PI $00$0 00 0 (00(0 0 S P w P0 P  0   0 -0 Q 00`0Q00`0  \E0 -L`pM0 P@E,  ,K ,0  I`V`P0U0p S04U -L00! 0S^  R00 0 00R000000! p-L@\ MP0lQà00!Q 0  0 00!`0"0  0  00!l((0 Pm`P% \p 0-P@0l LA0S0 0Slᄌ00" 0-L@M?P:  K /0  X0S0 C 0<"0 -L@0! ! -L@0! !@00@ 0 ,0  -L00 00 00 0 0 0 0  -L@0!q0@0000 ! -LP@@@@\0 ! S  @        0    P0  {Ppl0S X0S0 C t1P$PP mp0!P0 l0ST0:l0S T09T0TJ TA@=` H@  0p10x!@ @7P0 0 >0 0d<" 0-L@0 0P0!P0  T0.  :T09T0T!@   l0S0v0 -LP00S@p  S  S  ````@00` 00` 00` 00`\0 S(":S0 dA Pだ#3 0\ 0R0!#00 00 000Q00 00  Q0000000P0    X10 S 00 u0 0U00 00ĵ0  0U0000ĵ _ [0  T N J($F\0S ? ;\0`S   1 -T !R p-LP`Q% 0        \0SA p02       \0 S@0 `  `  \0S p -L@0 P"PP tQ ($ 0P\ 0-L@P0\.\ \tP <<0P( 0P@@0 -Lp@\0` S` 0r0 cR(RR$t0S! P0S}00VtP X  0@#VP $  0 # 0-L@0MP P0 0  \0 SKPPKbPU P0S 0t B P PUP P 0 p-LP@0MP `0 0  K6P! KSP0PP \0S  \0 S P \0SP p - 0L#S 0 SQQQ Q -L\0 S00 -Lp102cA XH*Q`00PU `0`SP0 hQ\PU m  w0 S Q``00PU Ґ`0`SP0 PȐPU I  Sp X:P;`00PU `子`0`SP0 DP8壐PU $  .P"'h@B -L@   -LM0,  0 0 0"2(0 K~K}K<08 2<0  Q4<0 (0S0(0 K4s s -L -L,s -L< \0 0S l0 Q0 10^P" -Lp` 0  1l`0 Rd00S d000b01^"81@R^: : ; ; ; ; ; ; @@N0R2 SS ^ ^ 0NAQ0l` 1  0S! lh01L 0"0  i,封ᰃ@040 @ -L  p0C2  01cz/X -Lp@P0M$ QA`C`P[`p KfU  [ ` ) U00L0NU [ ~j -L@R ` 2 ("( R 80R , ( $ 202#0 0-L@RM oPK  [o C2DD 08#8SSs  [s 10 ` 0 -LM2  P D K 0 S p-LP`Rp|000ph0S A00S 0"0R 00S1Spt -L =?0 㻦 0-LP@,t ,4 SS0 S h0 0  t@ P RU^ 0@0 -L@`\M0 1cQPT0SPK@KP"2pP 7 0S  P =)|K <`p0Wp tp0 `p l0 P0`0V  p  0*P P`8@ p-L`8@080 PU*00PU:0 p p-L@`P ? 0003S  &PT ᨏU00 @p p p-L@` 0P1U#p)0eT@!=?0 0  003S \00@p pP" -L8 M0 1R *0b\00P" -L4 0Ơ1\*0  0 00 7001\*0  !900  C0 nP P" -LPpM,0 , 0`0 V*0fW1! =?0 0  003S ᭏P 6 ` PpjW, &P *' %P"=?0 0  003S ዏPpdP`W  W 1*#1@P& , 0@ -Lp`M,0 , 0P00 U *0eV`0,0 00 P p`iV4 0t&P 3& . V@1J#T =?0 0  003S P"ᖎZ @pP0 `V 0 &00,  0@ 0-LP-? 0 3R 00$ S 0LS Q:n0@0 0-LP-? 0 3R 00 S4  0LS Q:n0@0 -L -L -L`M, R, -? 0 0  003S  Xi:0fJ$J 0  003SR0`P,0 hd`~0p, 4 8 ۜ40PP 0S @4@iT@!  pW% PU 0 S0  8+0  0  003S Q00S DzW0 C8. 0`,P, `(=?0 0  003S, 0` , ,0S  - 0L 0 C ,P 9 -L -L 0  p-L`PS S  0`p 0@pp --? 1L80<0Q -0Lc40Ɓ ,:1S) '?0,5? 0 R  #6\ 0 T b2b217c!0 bBS 0!000! P"P" -L40d Ơ@0N 0S*1\*0  0 000 !90 0P" -@0L0CS M M M M M $N N N N 0000|00t00 l00 d00\00T000S 0S  T,th 0-L$PC@P ᝌ0X -L@PK? 10c 0\  B   -L0 P 0 p-LP@' M)`R \0 SPR1S1SD1S 41SP41S K?D`4!0ឰ p -LB/!^ !AK1! !ѡ -Lp`V0!Q AAdPH Պ0 `0DPp00 1, D00Sp 000!" -LP0!! 0 00D00D0!" -LP000!!$0D0S00D00CD0!" -L@H ㋊01 -L0! 0D0 0D0!  -LPMM?@,`KHp, (@ S00P000jP  -L@P 0-L@P@P0!D0S0֯0CD0D0S ܢ!0X -L 㑋 ΢ -L`VPM0S VP @K< ᰖ+KXpKH p0!Z) !K1pS =?0@Kⴁp 0 Ӧ-? 0001S 0Slq=?0 0W@a Nvs!0S 0S #0S Y/h0S" Ph  0S @P KH ά|t% h0R 0S h<  -LX0 8#Ƞ R 1S\10\ Rh" -M?@\2LS$!RXڮ0S %P崹P ]  -L S -L S -L] -0LRT 0-@>0L  PP @0S  ᜡ0 0-L@PP 0S 0 -LPP  R \0S'=I00$2R00 R\  |2R rd20'=@0TZ`P 0S 0S >0  @0S 40S  4  /D0 BO!^ !AK 00! ! ,A(q(!Rڈ0S 0S  v r$1S0\2S0\2H@TY 00($1 h0S Q @ h@T0S ⓉV X Bl"\A -L^ -L+ -0LS\ -L}?p\bPV P+  " U$A 1S T  U 00(100C$1$ 0R0\2HQ -@-0LD00P 0   0000 X0S  -@-0LQD00P 0  0 000 70S { -L` S0\@pT2A 0R *A 00S T >0P \  0 @@T00L0T<" -Lp SM0, $\2 RRPŸPQ 0!000!PU  ,  0 @A\@T@ 1R @!囬00S T l0S  010P4  uw0 $ R@k ,`08   > 0!^ !ASK 0S @R> 0!^ !ASlK 0S@A40 ,08   8 V019# PP`V -? 00PS 0S il"TZ 0L 0 PP0> 0! !6@00<" -L$0!^ !A K騈 -L$0! !騈 -L  h MH , PP 1 c P0 AT8 0 D < @P Bἠ K`1T a0 4 S $P0 000X 0 @ S$P< $V1SJP L 1! 040L L0T0S$P8 L800L0Xp0S$PD  $#L0P0 0S8000SD  010 1L0D 0001S41041DDAP0 A4 0S000@ 0S<004 01@ 0 1D 000 41R041 PH XX 0S PH  0SJ F WU `0130H0 1S 1S41S H D!4104141 041h0,0@ H 8 R X <0S 0 R  0H0  ۪  ( -LPDA`T T0pqD0 X0qH p00C0 00009T0@AD0 X0AH @00C0$ 00009{ -LTM0\P0U> 3R >#@@T]|@  K0!Rpa1S00|0 WDa1W>\=T01U z> 2X0!1R p> (\0 !1R f> PQ$ P01V Z> xT0!1R P> TX0 !1R F> 0D1S h0S  41S V |4! 0Q0R@X  )>R  @)0R  @Y  )>R  @)0R  @T hKΩ|0S 41@CT4AhK Ὡ04141@CT4AhK ᯩ041X0\0 uY p  @ <T\h T8l\2S V S0\2H RX` V0)0S[ Nቃᆃt0S 0!!1S M?@xK00x0 t@ ᭠001S t% 00à 0!1S!0S  V D0S H -LpPMp 1t0 p0  P =?0\P K?;0 P|200;8#d2P\2 $ R 0S R  0;0 2P7`1@Q1ᆐ0U lK P 1!P0U`Vl⌄!L0Pb 1!0H2f!  lK@P<l0'\0">ll1S1Sd0S @@t0T0l0>0 00-? 41S0<0 Q@T  t=?00S Fꛚ$00L#!""(X?0S \2S l (1S\"00(1l 0$1l1S1S41Sh`0S]?P M@hK[ 0KϠ|l0 A d"000" -L| -Lp`0\P0U+< 0 x0R <h\ 00S@00S  p4T -LPp`0\@0T; 0R ; ħ00S R?xP"V )>R0  <0S$1cQ=?0|=?00!41<@ D0H1S)>R0* T@ 0-L0M-? 0K\2PS (0041S0<0(P ᅅP K Y@K K08|0 -L=?0 0  003SN? ᕃ\  -LP`p$@KM=?0 0  003S  ZP݂U N P $P $$1P P N? K  K0 -0$L RR00-? 41S0<0 Q `0@@P ;<P 0!000!(l" -L P Q0;0;0 -L?0S (1R 0S \2S (1SQx0041S0<0 Q H D\2S0\2H R\0 0(!$( -LP=?0\2S$τ -L`pPuUM?@\2S S(!0RሄPp W0P$q  -LP=?0\2S(Qڒ -LD=?0 0  003S0 r\ X -L0HP \ p-LP`M?@0000S0Sp -L0S0H@R0S P =?00S T -LM\@`, T9 3R 9#ɥ00S 31pS1SDq0SC;H 0CS><| | | | | | | | | | | | | | | | | | | | | | | | | | | | <| | | | \   0 R\   0 Pt2U  0yPH 0IS/$} d} d} d} d} d} d} d} d} d} d} d} d} d} d} d} d} d} d} d} d} d} d} d} d} d} $} d} $} d} $} $} ePP1X v =?00S 0I S񟗌t   T~ h~ ~ ~ ~  } ~ ~        4 ,~    D~ x~ $   D T `   ~WF, x ,tπo]?P\2Se0S R\]"Y ZTTL(T ^I D$@<s>84V&V1\   0 PT0Up(P\   0 0PP -LPP> (a@P 0S 0S @p%\2S Vڈ0S  (P 0\05 7Q  40R\0S  H@T -LP 0T P<1 4 -L@FpP; >0  UZPS_`. 0!0PLa0P!$1S ̈́!00!=0a/ ä́0100!=0/t!x1|1 |!! 8t% -L@p>`0P `FU`  08 0-LP      l00P::0 R 9S M0 (嶣0 00 0008X p-P=0L hpUPSO(` 0!0@La0@!pt% -L@47010-U- 0$1a?t1x!0Z/\A`dhX1[?00B?.E?00>09900. )0 9I >0$<(0 <S  *Pb:b ! 0-LP@xP; !0Z 0ESFX h l l 0 0910 P# p099<=0 P< 0  P 09<.),+0); S0c  P0 09 0l0 09S 0C0 H00 0E0P000909p0! -Lp@PPMxPp Wp!PWPp#`=?0 0  003SlK p~`W lK|V UPl`KUD* 0BS( 0 0 ԍ 10 091009<)  9S& 0 000  09<9S 0C10 x00 0B000\0 0909PU:t0S  0lꏮ! 0-@1L 0P  X00 U100S ^p@%p90900鏮! -L@*<`R !0Vp? 0Vp; 0 0!:*0a:#: c*!>S& 0!:*0a:#: c*!^0 /p9 0 9 11 0  p*<R 0B!9W` 20_V  000X0!:0C:!! 0v   ^0 \p9 0 9 WR\ V, \Q 9` V0P 10 0 0PP0!Q9S099S9p9S0C99S-Q0 0  p pp9S0C90 1 0  p pp9S0C9Wc*<R ^0 /p9 0 9 鏮! -:L.c>0  <S  R -@H1LS x{R p -L@p`M9 S >0- P0!::c* bXX y@phʖC  l:nXX  ʆy:*00 :*!W  0S0 Y t d >0P =00S10; SQ 0 P  0  20 00PN  0 P 0U8 0UJ:> 01 S2   /p9 0 9 0!00 0= *1R&0 U0#  P U0@ P0  0U0U  0 0U 0U 0U $P l1 0>>0 0U 0U 0U 0   0U% 0 " N0  0  /p9 0 9 1 0  ^pp!0U(3 0S"~0L /p9 0 9  :T 90J:$JT U  0HE *3R}=0U,:R !zP10U !0UQ 0 N 0 *2R],:R9<Q10U100S 0!: S ):P:*0:#: :*!@0!  y: S ):P:*0:#: :* <*0, <!R!Io )>R N0 /p9 0 9 1 0 *1Rp U,:R9<10U100S 0!: S ):P:*0:#: :*!0!: S ):P:*0:#: :*!10 $P (0S % 0!:`Ÿ S )::*0:#: :*!0!: S )::*0:#: :*!510@{, 0!:S )::*0:#: :*!0!:S )::*0:#: :*!0!:S& 0!: S )::*0:#: :*!0!: S ):@:*0:#: :*!  9P@099 d00bSK ) 09) <"hK ߜXyt0S >00 :S Rp n )>R  ЏPxP 0S   -L@2?/1 3243!01S  0-LPP Π 0 00S> 03 0 00 >  0 e N @ x10  4x10@ -x! 0' &x1"x1x x1x! 0  x1  x1!x! 0 x!0  N @w1w! 0 N @w1w1w $v.00000 00 0S D0{.0000 -L@ P 09 0-LPP0 9S t0 P bP 0 w@I70 000 8" -00$0L RR M?@\2S$!R\宛0S P劦P  1 -LPH@K DMT P0 L w=?0\ D0 8K9SzTP>X 0!` !010YX0  St2)>R T20 S D2X ` R` X (2㳐T0  >0!^ !ASRtK 0S |>0!^ !AS8tK 0S j \ 8 0\0 5h\ 2 \ / 80Kd0 dh vD$!00L0L0 CyP00CP0 m?`00L00j 0cSS4[0j 0c0>0 <S  : S Rh 0T2P`0S T0 0Sht`Ȍ` hv A=0L1 P00S 0L0 xP00CP0 >007 P0S :S  v):@0!:0:#:*T: B* <0CS <0 <!0Q0T0S L0L0 xP00CP0 TrP0So :SkLpKPKl0 0!:Jc:P T@T@!!T"  0L 0 3:R vl @l0!:0:*#:: d*!L0P 0L0  dP 0!:Jc: T@T@!!T$ =?0 0 0 3:R gv @`0!:0:*#:: d*!00000d0l 0SPL00j SX0` R0`0 P0S =0 D1 0S L0 S Ns>0! !rۙd K)>R@0=?0L Q P0\ S sA uP9\ -L`PH@K(ML  )u?D 8pK1 0L@  00$ R h1R P ^HS.P ܐ=?0 0S PD1S 41S;10# >0@wP@`FV  P p @`Vt0S   0lP@``V 0 u P00嬐L0TD -L`@> 0PUSp nUt  n!0S>0 <S  Q: SS =R0A`` D!0 C0R`>00`H0P`Q 0S 0SL 00 <0 |PxA?P`A -L`P@@K MBt}|0?prH@PUQTOX  < 0rPW> 7JP0HT@!0eT@!T4 04 ,:@0 `P,P*,00QPP:0,0LD0, KPC6`0 V00R0S ,3Vpf<040<0 4 ,F@ V <0S `0@8 RT|m`"$#,Kⵈ 0-L@PD 1S4QS41S8ʙ  Z V D!0R00( 000D  FD ADn1SnK_ 4S1 cUD(Dj0 -@DLP hn -LpMDQ@U_ =0 ZW p@TI >,0 !^ !AkKa' TK`=?0 0  003S  o`T n@T T@T p d  0Z P@ @T,0! !k  Pp p 0 -D!LR =0  -@DLP 0S1S  P -L K?1 cp -L0pP Q +nll -LP$N0R 1T@ -LP,: 0R 0 0T 0-PDALT =0  000 '0A -L@P1 DQ. K 1cP(p01` bi .04QUl mm1SD1`! 0  l  -!0>0!0L00 -L`@pᘀ PUT0xx S 0x@T`d@ PUT@fT00T 00 00 -L pM@`!^ !AjKQ @ @T 0ST 0S P P   R1! !шj<@K 80mx!^ !A_jK @ @T 0STJ 0S P P   R< @ 0 S& P 0S Q 0!00C0!0 000T P P00, 00T Q 0!00C0! 000(0! !j , -PM 0LS30S0p!^ !AiK` R 0S R 0SR 0S@QJL01 S2Q ! !i:,\ #?Q 0 1 0@P 1=/lP0@ @0  0;` 0 0 P 0P! !ќi\ #T # X #! -L@ 0`S 0Sp!^ !AeiK 0 0 00P PPW<0F>S @ 01 0! !^i,\ # -LP@A0S0`@ pR T 0S T0S BmPP  ,kA]P( T kP鐊 -L 0000 0 (k -@(LP  -Lp`B@0vPC/ `F(@P00000 a00!0~!"000 "00 0 "00$0 "001 " "01v1#1T -0L 0C0EI02R0  -L@0S& p 0 010 0 0 0C`V TPkPD@ 0!0P@0P!` # # # # # #t% -Lࠟ@ 0Rb1 ȀP 0pR! 0S00T0@0b0 Yt0 00 0 B0Q0<0 0R( 7 # # # # # # #P p-L@` 0P& P0 b0ca R b0S0cQaR d0R "$"""! 0 `"1  """$ Kp<"U3 - L0Q  # # -L # -L#Q0P  # p-LPU 0`A0S 0S pt # -LP@?`0 `V0#4 H0##?T0@Z`Pp@'VV0,0д 0  ;V 0 0  0 0#=0p `!` OV0@000 0 0 0 0 0 yZnܼb -L`WM1 '0 2R0ŀ!' 0S* SS@@BBT@("0_K!_K Az 0 S _K1 0_K 10 0 R00X01B01 0R  0 X0 0} 101 -? 0 S 0 SJp'Pp((((0$!U| x t p l! _OK(20'P !a0pUP _K!P0U0#0 XP1 P#( K1tqSt0'x'p =?0 0  003S  iPU % # #\#EgܺvT2̴  geXsX 101 -? 0S 0S 0Z_KU,i  # -LP0 \ 0(0P  0 ` # #t -Lp$KMm,@K @`$0 1P,0 ( d g \`PU  p-L#P 4`Q0S@P h@p # p-LP 0`Q0Sk@P h@pt # -LH@KP Mh=?0`pUD0 8@K@ `/`-`+x D-? 00UUUP000S01PP (0 0Pp P # #0 0SU-? 009W 0z~W -0L0a # 0-L@l0PTS  aPTQ  a808 0,0QA A?Q0P\ # -LPpR@M# @W`1@`# @=?0 0  003ShK i@\ hK hV pl PhKP0 "!xWU 0, 0P00$wh #<"  p-L0R  3R 0R 3R 2Rc 2R) 20|jP p-? 160<0P @jPP_|Be0l"0QX ]?P160 <0 Rp@2`@DjP:j P5@9jP/RpR  0  003S( h\ p-? 160<0P @@iPPU@@i P p  0"P2@0 0Q% ~ -? 160<0Q t0 0 p-? 160<0Q 0@~ppR@RRR@R #P -L@0 0@0?  0  0-LKMPPH@0( l0 000U # #0 p-L@\`\PM d T@@R@T00P #p#p p-L` 0P0Q\10 =?0 0\ @@  003S *h@T fT p0 0R p #p# -L`pMPUPK000Sn 0   $ ( ,@K04qLK @@ 0D@ 7 -LMp`W00V0S'PU,PK00S)h@PT T@#=?0 0  003S fPhP  -L8 8000 0C0( 04 200t#x#|## -LM 0*00)0莠 0'0, 0* 0霠0(0 0  0'0ꪠ0)0 0(4 P0pv 0*00) 0莠 0'00*8 `@(0霠0(0 0'0ꪠ0)0 0(0pv  0' 0 00 莠 0( 0  靠 0)0  ꫠ 0*0  py  0' 0 ,0 莠 0( 0 40 靠 0)0 80 ꫠ 0*0  py 0' 0#0 4莠0( 0#0雠0)0# 0ꪠ 0*0#0px 0'0 0# 0莠0( 0#0雠0)0#, 0ꪠ 0*80#0pxyZn -L M 0*00)0莠 0'0, 0* 0霠0(0 0  0'0ꪠ0)0 0(4 `0pv 0*00) 0莠 0'08  0*0霠0(0 < 0' 0ꪠ0)0 0(@ @ 0pv 0*00)0莠 0'0D $0* 0霠0(0 0'H (P,0ꪠ0)0 0(0pv  0' 0 00 莠 0( 0  靠 0)0 <0 ꫠ 0*0  py  0' 0 H0 莠 0( 0  靠 0)0 ,0 ꫠ 0*0 40 py  0' 0 80 莠 0( 0 @0 靠 0)0 D0 ꫠ 0*0  py 0' 0#0T0S,aTH"P0@1S 41S @>TP01S 41S>T086Y8 E>P/P @P0sY E>Q'($Y 1 0S`VU00k 00f @Pch`U\?UU@0P01S 41S 00T 00T @>T?0P0PE1S 41Sx00U t00UU* u'Y z`P!8Yt`P!Sv#'##'#Y 0  003S C 0  !0 0  !0 0  !0 0  !h0 0  !x 0 0 !XP3@@V Z Zb Z jRb WU X Hb X Ab VT3@V3`  >0 FY8 K1(2 "1, $2  K0,2 1C(2 "1$2 "0 2 <2 R V*Y' $"! 0  003SㅏK%nK ^ L]Z2T 0T7Y 10"100! 2 02 0K2 !001C@0@0! 2 02 0K2 P 0  003 X ḀXS㰀 ]\ Y%@ 0  003SK s^@K\TGY,2SoKd@P  0  003S u]\ Y Y ###kKYv @ 0  003SoK +^@\T m1 0  003S&nK ^\X TP 0 1030S E1T 0TY1 &>K 6&>K 0 .,0041S0 <0 Rh 00T0041S0 <0 R 0 0#fK(# -Lp<@K M[=?0,PK80 H`w-? 00@$00W 0@DSr<#w=?0  0-LP@xx 0 0000 0000L (0 0S0#'# 8" -L`0p0 !A Q00X S0@T ứP 00X Sv s###< p-`L0@T x00Sf P `P01 R ጩP01@p 010S p### 0-P4L@D0@@D> P0 (01$0 00## -L`Pp@쀟!^ !AXK0T T T ! !ѰXPo 0P`VVU 0`! !ѓXЙ -L,M, 0 8 @p40 !^ !AbXK4 `0p@0 1< p pG<  P  0RD S0h0@ hQ!@ TJ#T1R0 P !L H &< H_P@DH Y0e`k PH0LUL < HP`0@DSSX0P@000P TP Jh0S@D@L ` L  P0 T0P0 *@Й###DT)`F?`LHT _P< CH0e`0@ f@DPH T0UT0 < ,HP `T& =?0 0,  003SP Z~ZL , D00 0 i, D0 0 0Q 8`XL:0@D 4R~(! !іW Й -L0M0 4  P  T < @80 x#!^ !AbWK80`~ D 83@ P J@  P <tH 0@ST  Y00 40iH \!\4 4p Wz#~@=?0 00  003St F[@W XYt~X pWH R <9Y*0iWp!D0ŸS1L 1 `Xp * @  pP T ^P0eXp`WpGL T@ L  PT 00T0 U @ OP`T WtY *@KYX\ LpG ,0KL  `W00V0S@ R O`F?@^PW@ @ P T  pGL0P@ L0 B `PP T IU @ PT /0e`Й### pGPT LT 0L *U @ P`T WW L T@ T 40XH0 0l  40 P0 H 0 S T c 4Q 0@8 H}(0! !TVЙ -4L @P  -L,Kp@ XM"dW +K@@P 0@@*) 0@@))X#+K Up# -L\=?0 0, 003S  0  0P* 鐓 p-LPp`=?0 0, 003S @@pD0D 00 0@Tp鐓## -Lh@=?0 0, 003S  00 0\چ鐓 -Ld=?0 0, 003S 0 000#40Q鐓 - L0pW00`@T PP PU00`VZ`Q@P 00`V# -D01!@LT 0000CS0# -LM, 9PH 1 11` V00VQ< 0R8p@PPUP1S P Q U_P UX 1p@WT T00W0S X 000, 1 `o Z#>Y -LMpA!(`"VP `P   01 R(3@QU 0PS 1  V?00ᵠ0 *00 p-0a1@LT 0SpT  LR  uPPT000 pV001P$0T  p## -L2M140 1p!, 0 0 S,0S{ 0S/0@Pt40`1<` P8  8  QU  \1#R < @ a@P@A<?X08#8<0 \`V p 0W000,0L8#s,  0 !0  $("(.P0 , 0L8#s0 , 4P 0004 1 pz e ##`4 `V0 -L 1 qR 1PU0001U 00CS0 K6P`1嘐P0@T ("(P@T`VmP100` A`VP## p-LPl0AaP 1 Rp10S *1 0001 p# -L`!X+ @qW$ P\ 0 S*0` S3508#( #< 0 00#4 0?PPU@T8#( #< 0 V # -0110LS# -LQ 0AS:A 0CQS?0 S   1P 5P A30P ?00 P - 00LS '@! -LPq@eĀQM `D"`1^U**V( 10 S  0`P0 0!%@fS0 0  Br  Br# -LPqeภQM `H"`1^U'*V% 10 S  0`P0  0%%0f@mS@@D0t @Dt# -LqM4 Q0L`\ @@d@gY0PP010S0# 0-L AP0 00 R0 0 0 1 >10 !0"0" 00000 2S0@;w<20"" 00 00  0#### -L>XpQ0S7Oz`P 2 OP㸠F?`0010S0b@P @@0@ 0000<@ 00S  ### A -L` P \3IMpP01 #*\4 01041 P8 01081 04!81 @! pWQ# -LJBPQ 000# -LTT0T 0\10(\0(### - 0L0#D -L`q唁0@S_P taQ0<0S 0(000(1Q00S00mV包0^ 0   ;V{ 00`0<0S 0(0P00 h00S PH0Q 0(######<", D ## -L -L -܀0LS2 PPrc`0q0@T!0  \ 0 ӄx00@S TT00(P f ##t##l <"## -L3 -L 00# -@Lބt0t 01S 0S X00S L0L  冄80 R 0|####<"D  -0000LS 000## p-L `@PV  @ 1@ 1@00  A0 A0 A@PUZV# P2P @@Tp` 0 0 L 0 0 8 0 0 P>UpP# -L -L 0-LP@@TTT 0 0 @ 0 0 , 0 0 f0#P -L`H\2M 00PS@<T  -LP M, @0 XT> =?0 0  003S  0 00!x0 0 !H0 0 !0 0 ! 0 !p@ᵀṠ0G8#x0D8#H0H8#0@80 # 0 B("(Wp!0C8#8T@!X!P!Z 04&00%P<P    ,0t0##V0`P3ß 0R 5h`00Z dL X p@_ Pp# 0p @P `GX  P X1"0030 P@ 20@ 1P @P) X  P"X10"0030  0 @u@p`q@@@`@DK!CT400嘑 0` P@P @P`V! PPP P 0 `@P @PX } P@P0s g  0W0 Tj |0 bh d0#d00T0W0,  g0  a} '###'#S gP0 0np4`@@PY_= )'#'#pP /P0`@U P\00` 1P ?PV@ 00`0U0 0c0'##'# -LpH@K  MY:?D 8`KP`VX00 S#00>0 9Q,00@i<T<'#'#@d0 0 8D00S 800 STV=?0@@'#'# 0-LH$XUM0 U*$ G?D0$@$ ?<?90 -$0L0 S   % -$0L0 S   % p-L@QPP`M0 R0010S0 9S00 0K1@ @T@@00 T@ UT \00P TH 00 U 0 0S  00()#,)##'#D %0)#T [  00#p -lL0@0P0Spp` <<"00N:P(2` P:T00!tA0VS W 00VW0P0 10S1!1!0 t00h(L00@Tpp00S 00@ ,1 R< 1 0|P30 00  #AT% TU0PW 0S5 U0P 0"ATx0 U 00VW0@00D(#$)# %8ؚ<"@<,)#'# H -L 80 R 0 R 0(#(#'# -LLQ |1 Sx!0|100t1x!t1S,)# -p@0LS 0S |! Rx1 |!t!x1t!0S 0S,)# -L [0O00  -D@0LS 00 000   )#D -800LS (00 #100#') $)#D -800LS (00 #100') $)#D -0LP D0(# -<00LS ,0P =0 v$)#,)# -(000L PD -800LS (00 #100#') $)#D - 0Ld# 0-@P0L@C@D0T t>@P O0# 0-@P0L@@0T ?T@P :0# -PL\ |1 S x0|100t!0Cx0t!S,)# -L -L -LU -L 00)# -,@LP 0 P008)#<)# -0L 0,)## -L -LC -L P ,00000CSP 0D -L \ 0-L@ ,P0S  0S@0}0 )#)# -L0 -L@0S )# 0-L| |P0@^ *d!0 S 0S 0^: T T 00 ?0 )#̮̪ -Lf -L0P @̦ 0-L@QDQ00 410S(10K0002T/ꠤ Ȥ Ф ؤ 0$00G!0800T00  0D(# -L 00 0D -L10@S:P \00 #10') \ 0S 0C 00000S0 00 00\ T00S P@p 80000Sr00$)#'#D(#4 p-L0P0@0 0\` 1S 1 S2 l0 00*#B4 SS  R 000020^Z\p'#(#(#  -L@ ,000@ &$!D -L  P  0@ 0s #04 -L $00S00 0#0$)#D 0-L@P@8TX00SL 00#00( 0#1S0 00#00$)#D  -0L -L0<0088080g6P l@)#  0-LPQP@01@  P0 ȁ 00800'#D)# 0-``Q010L RH1 # R00 0 0 0 0 0 0 0 000@S 0s 0 R00p 0 10 l 0T `00@S D00S 0#'#@)#D)#$)#8()#,)#D %(# -Ld@ 0!000!H 0S <00S  0!00C0!(# -L 005P l$)#  -L@ 3@TiYx -LY @QRP0× 0@‡خ -LY @RP0ӗ 0@҇خ -LL0S P, 00P  x)#|)#)# p-L` 00S$1p\00\@@T0 0pP0S% S SQ<0p  SEQw00@% PX@p6Q*Q@pl00@T0PPXXQ @ Y0A0@0P$Xph)#خ -LUP00XP0S 0-LQX00S L00S P0!4@005`002 e00!0)#)#d` p-1L0a@Z 10PN @: p!0S U0C0D UD10S 810S ,yX(10PPX/1P10S' @0 P0ʠ0ʠ\  ) eK 00 P !xw4Phj000`V@ V@6Xpd'`)#l)#Ю4)#)# X -$0L 00!}00!(# -Lp`_ሠ刀 00000l52PU`X0@T 0S 0`FS$W|)#)#x)#x 0-DPL0@S P P000 -L@pP0 `0PS0000S000՜0 S `@  R1 Q`0@ T0 S Pp  R1 QP0p`逯 -L0@sP oPk p-LPPM 0$` @K0Pꀯp 0-L@P0!0@!0d 0-L@P0!0@!0` -L) -L# 0-L@P0! `00 0@!0d` 0-L@P0! 00 0@!0d` -L@( 00 0@00d)#` -L@0!! -L0!$0 0::0 !)# -00L0'P)# -L L 0@CT@ ej$0$ P ()#L!)# 0-p@0L0S0M$T0T 000 #880P f(PP 00C0)#)#L!ȱ 6GX0z.30 -LD@K` M2=?0@0 4@Kp PR0  8M?000 R0SH=?0 MV T@X4PEU0 RV=?00 S)#0 0eL0<" -LP@Rp ` T@ @P>4`@TV 0 0P0 <" -8@L0 Rs *0 RA)# p-0LQ& P`0 0bS0@ 00#0 p0`00XX 00D0400, 0(0 00p@<"p)#dt)#x` -L  000 x <0  00 T0dL@6@$w4 H,, &\pTqX<")#H)# -LD@Kp` M1=?04PK@0 \8 V5 L ?0000!h 0000!Q0  0SGV 3 @ @DH\3@T@-? 00L -L|MPQ 3Rd 3R R]3RZ |3R x3Rp 0CR) 0R$ P3R6 `:0R (3R $3Rc 3R  3R 3RP 2R 2R  ? A@"08 00!000v00!,2 0R -? 140<0P @b000!(Rd(B-50000u00000!@L@K$f0$@=?0 0  003SpK 1@pKQ0T h[l[p[00!H! 0;^0<1 001!10N2;\1|!10L2P0!10@2 00000000000000!L@K$0OD p@p pppp$@p@ p$@p$ p p$T)#X`<"pq-? 140<0Q& $@ 0  003SK S1@K/T .[匀[p[0 [v 0[#0^3Ã211^3311^Y00 Z0S  P H3Z 0 0Y;W00X0S0  ;R 30c^00!^00!B 0000 0` 0`000c^ 0d0NPࠁ 0>Pp000 000! ʃ0 0N0000 10J 20000!10I20000 10H' 2000010Gpǂ2pp00p!10G2000 0`0 0P000! 11k 0ES00U -? 10<0Q< 0UU0Uh00!xh h 00P  n0000000!l0}12QHdpqX`P0U?-? 140<0Q 0Pkd$=?0 0  003SLK A/\  -L00!<  00!0 00!T\ -0L#)# -0L0@S# 00!  00000 0000 x00kt00!0   00!8000! 000DpqT)#\ -X0L0 S @RQ y'00!$000!PADH\ -L00!00 0d@2sx0|0!xx 0000 40 0000!@MR8 YE00 #TX<")#Q\pH)# -LLMP 00!0!0 000 000T 0!0X0 `00!LPKP8D H0LvΌ <@@ @9P0 9D Rx 9l 9H ;RL 8@ 8L ;R ( 8 pqXdXdlp 8X@ `P 0 0    pp ``@L@T p `^PP8P0 cx|  -L`p@Pc0P0 dPP00 -L00!! 001 00  !S 00`S00!\!\0000000000000000000 000000 00000 000000!0C21 0B"!C21 0v@B"!C21  H0B"!000 L0ES0d0000C0<"pqd -L00! 000000000000000 000000!0C21 0B"! C21 pq -L00!PPP 00 0000 0 000000!pq\ -L00!PPP 00 0000 0 000000!pq\ p-L`PP F@ C@(@`* <@*PUph -L`p@ -@VP @@&@*|@ 0`p @*PUh -L@`M0 !(0  @ P@c@hp_@|*V r*P@M@(0!=?05Bh p-LP`M0 !0  ? @?/@,@LI*p ?P@@0!hp -L    -L@      -L@   -L S@M =?0P L 0 003SR ` KK +\ gfff p-LP@S0EM S񟗕 ` 8 8 | -? 160<0Q SU-P  <0A0 P 0  003S K ,P&+U h K0 0 0 n^ `KTU0 00  -P=?0 0  003S +\? > AWU- - 00: S 8? -P -? 160<0Q F-P@0!Q>!@!p -L`$PKM 00@: Sp@!> p00$ L00$  5<б p-L`P 0 @S  0 0D 000f0`S0V N00p#  0-LP@@T ,N0S NN*0 L -Lt0Q00t0 -Lt0Q00t0 -LT -L)6 Z): `0M0P, @Ơ#vYZ P ,0Q @dN800@&#Y ZXN -#)#t-# 0 MN,0x` p-L`4P@.4P ʠ8,ʠe`a`@ƌ8e"a"!'baA\P p00S300005p9pP" p-L`4LP ʠ,ʠ4@.8 d`a`@ƌ8d"a"!'baA\P p00S300005p9pP" -LLPp4P ʠ,ʠ00 `48@ d"a"!'baA 8d"a"!'baAƌ P`FV0`P" p-L@( (0Rt00ht0)P`P(` 0!0P``0P!p< -L@0!t0 0t0( (0R D! -L@p`0!X#)0 0 0P0 00 P0 0 0 0Sd0 jPP0S0C1 S0 00V00C1 0$`S000!# p-Lj@@M 0  0 PXKPPPP4H0#4S`QPVP P000p -LP@M(0  0 00 D@ll@l`lplth0h0pP\0HL@P`TplXt0@Ơ#*n@  p  -# -Lt@  $0R  0S  R 0"R T T0S $0  0S000S00S 0R\ 0 00 0C00000 0@@T -LPD@K M(}?p4`K@p 耀C0000!t  $0R  0S  R0S 0t0( (0R D00!>00! p@00!T C00 -L 0S  P? -L < S"21 0(# -L ,R Q 2<0 0020 00(# p-P0`@00LiP P 0 322"! S0"10p -LD00 0a##P 00 0c  <" -L@Q Q R(00(000000R80080@00@0R000 -L@l0 0\c \ ,0$ 0 ,0$ <04 0 <04 00C0<" p-L@`KP KM|P  0 P  0p -LK KMf@T 00C0@T w00C0 -L@K KMMP P  p-LP0T@ 0T T= t0` $0  C0S``000Q 00C00Q'K0Q|!K0 Sd 0K 0P0 000 PS0&"03S 0 R  >p -L@`P  \$3 0R/!1R+$00S'HpW$ 0PP < 00cS P L0,0P0P0,0, 0,0$0 0 0ppFo -L0P @,M80 D0 0Ht0 &Y0@ 4 YYD0 YH @00H0 00k000 #!4!R< 01<0 (`0,0 L` 00!\Z X@,Kt 0< R `@ Q Q$ 'Q% ,0HP,  ,0P0,@,0P@, ,00,0$0,0TQ t0 0!000!0S9J,0!"  @-R9p h p | ` ! !"@0C#@0S   PR3^|  ^ 00 0XI, K,,0Q ,0LP,0#L!, L0,0L@, 40D0,0,0S8I008 R, 080 0 \ 0R:$@ N0S00! 3P, 8   +P, 00! p8 L`00!0D0 L!0,0H,0,0``,00 (,0$p,p,0 R!,0\ 1S H 0R  H R* 0R 0\R R* R V0 S$ 0S H0 Sp 0h SV0p0C0V ^Q (Q 00C0Q - 0LR  -L@(Pp(0 Pd0 S!1R$0S H0S H0S 0fS \,00 -L -LM=?0 0  003S 00     K e^  0-L@PM=?0 0  003S$K .@$KT  R0S 0 M-L@ 000000# -L\!1R H0 SH P* 0P RPP: -`0LH 0(p W b2b217c! b0B!6Q @00S If0(@PT= R $0S(0S Q0  b2b217c! bB! /<P" -L@X -L@% -L -1M1P 08 0L,0 0 0 , S Yv08n 000 k글H0p!壡tjgV`,f0 @P `Y(!0 4 b2b217c! b0B!6 0 4 b2b217c! b0B!6p  [Y#8 R $0S(0S L 0  a2a217caA/ #P"῎jX0 0-L@^H 0!4S\\  ZPP<0< @P <0# 0-LP@P` $R] x1Q0C d1QT0CQQ:LL1QI 0CQ H01Q8 D-? 160<0Q 0 1P0!^ !A[K 10S P 10! !_۰\ \0  D01 OŠ#+ aP0`^hr# -L`00 p 0W cX Z030#  jV`!V =?0 0  003 S  :\0@ # # p-L`< 0PCUP(@(0&P Tp# ## 0-L@0S 00S0 p0 h 0S0LPA0S 0000 0 000 ## #l -L -L -L`__Ppܧ@PP?U 0V_?00l0?" p-L`_O@㺧PP8f?pT V_?00l0p -L`PP@pPP`0 SS  "NDPV zCV eQN@eTP -@40LS P M - 0LX -  LlX - ,0L0@| \ -L D0ASd - 0L  -  L=  -L 0ASda -L D0ASd - ,0L0@|  - 0LJ -  L -Lm -L -080L S0 -L@060t 6XXXXPX`XpXX? 08$Q0a4qLd$05 ,\d p-L@0t 6@@@@P@`d0 08Vd`05pv -L@?6(0tP6< d0LLLL`Lp0 QLQ0Q4Q 08$aPqULD0 -L -L -L0 110141?d0 0& 0$ $$$0t08!$ 4 0-LP7d%P B@P 0 SS$B@PL@/d0 -L@dM$d -L@2>6(0t6}> d0((d0 0* 05l - 0LG` -  L` -Lj -L -L@0t 6444d0& 0d05P - 0L$< -  L$< -L4 -L -LPpx0l`S$ @ ]0PPx0S 0!x00Cx0!S/x0S 0!x00Cx0!S /0S 00 0o\ 0ps00X00d 000d 000 00D<" -Ll -L0`# -(0L 00bS 0n<"`# --lPL0SI BpP C  #` V:<z3V, 0 @@P0@cV@T@ {0`dSr0 Ck0VE p-L@l0P`P U <0d0S 0d 0p -Lp`TMlPA 4 yV7 tPKP  \# V@@@@d L#<@0` | R . @#V 0S 00 ORt K 0'0K0 0C&0KAV<! -l@0 010 0 0L100n]<" -pl`L0 S0P 1S$@P@P (8P (P00(PU $ -Lp`l@ 0(0PP o]0 0S 0S pW0 1S (1S pU00 8P (P00(PU  0-L@4 40lP  00n;@0\Xd$ p-LP@dl`6d 0R4 0Y;0  pl -L@Ml("(P 00000 -0l00LS  0-Pl0L0@ $ T B00X00<" -l0L 0-Pl@L\( R 0000 -L PM@ 5l D  00DD@! 1@S @ 0P \Xd #0D@ , D  !0@0@^0c0 1`q0@r@F0ch0 1`Q0@Z@.0cP0 1`D` 00v!0H0 <0KH0 AT2sP/0b2nT^sPmP<K0L Ÿ"H`VmU  T!`VH` @儀H T P`` 1`X TP\ 0`` \`1`mPH Ad @p@`d 0!`PD`L  0X0  llP H0 `S @0 0 4D0  ` @0S VD0    00( ,04<D8 H   R 0 D0@ D`H 0!R 0 D@ D   -Ll01S  p-L05081< <<<<@ SO- K@Y-0[ 0S-0K  0N +0[,[  #2 0 0. P@t#TD $4XT\84<xtd+0[0S-0K-0[! +0[00#2S-0K-0[A@,0[0S-0K-0[,0[00#2S-0K-0[ 0+[A,[ 0. P  1,” 8 ZX[. KX< ^X_/ KX+0[p "" .0[p0@#B,0[p0#/0[p0# +[0.[,@[ /[@@@ 8 VX< WX +@[P,[` 00pp@Tpq$A.P @40 cDT,T -L@MP@`s#` \1 0)0K\X0\080 0TU#20<0 40Kn*0A# S"?L3cX20/#L#bPUP?B3c0e0h@@ T@`0! ) KX00 S<Q ) [  P 0  R@TGo`G^ PpW### -$0L0@S # 0-LP\0@T0T 00 G P @T0##t -L`p-? 160<0Q `@P 0( 0PS0SP0 SoL0S jL0SeL0S`L0S[L 00   1 0 1P 10C 10 <L X d l x   0-L@P P 10C 10@0 0-@44LS+ <Q S  * *00S 44S ` *0PP0Q 44S $ * *PU0S -LP0̀ Y20000`0!p  R 1SqR 1SljR/pWp@0 P 0PYROpW 1 0C 1PI!!@p0 0` 01@000S 5>0 D`?VROpWZ0` ! !@p !P 000 P }000 0 0 ROpWZ! 10 1! t -LP@P , @X  `}p@00 S0000 10 000 S000R0RO`VX Y lY\ 000@`H0 0SNRO`VZ 10 1 R t -LM M P0! 12aT"T0 `@0  1S0PRO`V!000$!@`0 0P 0p1@000S 5>0 DpP?U RO`VZ@0!D P @4@ SRZ p`@pP 000 00000S0 0S00P |000000RoROpWZ000000 S0 0 S|#t000L4S &0L4H4P4T4X4\4`45N"S0|#0|#0|p` V1!0q!1 1p!p t|r|(P n|,P j|h|pIK@ @ # J?I/(Kᜄ嘤rPb0H!D@840A P0`UK\#dlÉptC 5> ( K@20t p?@hB ( K00[4 KNK@D,!?x#(1$! EOK|3#ÉCScs堃夣 #03@C0 @K张3#ÉCScs䃉裉 #03@C0 @pPK`4$ ĉD4T8d:P aHP [4 ?02>4 ?02!5J4?020@Ġ+1=-? 160<0Q 1 .4? )0)% =?08" 0T̠  003S \  0000 -? 160<0Q 180<0Q  0`-? 160<0Q 180<0Q  0`-? 180<0Q @ 0  003SK r@KT K'p-? 180<0Q  -? 160<0Q_ 0V0S0 0 0#100x 100s-? 160<0Q@ @0!0h4000S000 00!+PP -M H-? 160<0Q <  ?!P 3-? 1@60<0Q %0S SOP`3S PVw P?` p  0`8 -L r P 0D -Lx - 1LS00 0 000 -L -L -L -L -L -L -L q -L  -LT -L -L 10C 1 -L -L -L -L -L 000  -L - L  - 0LS41 00S(100S100S100S10 0S0 0$0S0$0(0S0(0,0S0,000S00000S04080S080<0S0<0@0S0@0D0S0D0L0S0L0P0St0P0T0Sh0T0\0S\0\0`0SP0`0L`0Ldx0 -L` M40 0R0 , 0 0$ pP@0S 0UP 0 <0, 0S 0 S 40Z#tR_ROpWGn `X -L@P0S0`0!R   0pS 1S !P6 6 !0#3S 0 3S 0 S 0#1 0 0`` 0R00 $ !X D -L@P!^ !AK`0! 1S0 0p !! !X LH00!! !< -DL0 S S 0S0 0 A# -D0LS S 0 R R0S 00# -L`P@Mp0 L00 SS 5>0@ 0!DRO`V` -LPUU*ph 0 0 @`0 lZ U 0P0 RO`VZG~ pXZE `#t|h  -LGPo<DDDDDDD4,$DDD DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD|xtplhd`\XTP  ,8DP\dlt| -L20 S 10S QrH$;@ 1+0Fd;  1+0E[ l1+0DR L1+0CJ (1+0BA 1+0A9 0+0@1 0'0"( 0'0!  0'0  ?'0 ?'0 ?'0UVW -LPM0000 KQ0K* [[ -LD00+"$ ,0'0"$?'0"$ VW p-LPL0`S @ Pp 0Sp -L P pQ`@4T1 6p pP'gPú6 c0 8X XP00P0S @U P0 1UP P PV U 0100p p-X0L0Q@&#jV 800 S,00@&#jV p-#-# -L 0t3S  -LP`p0!0 S @ 0S0000 U`P ~y 0 0``00 `! -LP`@0!00 p!0bS aS: cS0D@S0@0S00T 0$w0D@S0@0S00Tm 0$0(0,0004Q0@@S0@0S00TG 0 0 0$0(0,00040S0 <0  0$ 0( 0, 00 @0! 0 0  00 ! 0-PB/@M0LS@C<00 ST T  @b0TKT0 -L@`p T ̀0 PU b0AS00aQ   H10S000&,10 S R 0@ 8P0SD10D1 0 000 0S 08 08 R0(0S004000000  -L P 00 \ b0AS 00aQ 0000( 00 -L@MPp<`Q H00$0 0?< -`̀L0 08Dp@00!1W00S 0S @P00 #P08@ Jz0@S 0   /0 0 ( -0L 00p#R 00T  p-L`0PbS aS WcS2 T@QQ 1S ppD@TE  0(0,000400 0>pD@T 0S,O000 0(   80@ @  p p-LP`M 0@8#(# i (Q $1Sc0S`P@ϙ LV @0$S(10S S\:?0200\? 0  080 00@T00S@K 0 fP |m"0S0aS cS#0 $ 40(p -0 0LQ000<" -LP00!00@ 8 80R R 200bST R 0S 0bS 0S  0 0 cRڄ0 @\T% 0S" 0S T Pa0 0b^ڬ0S  0 0`0cS000bS(ʬ\T+ @ R T 0bS@QT 4 0D0bS0@$0$`S 0 0+&^i@ 00` V <0S 0`@00 00 x8p p@P 00!@00!@P T@0SI <"Xt -L 0P$3P11100U00S 0G Q0#t -L@Xc00 -L5p@` M04PK,0K<0 80 D0KDp @p V8 0 Ġp 001@0HP0!(0S VV pVV 8  0@0 @q!V`0S -L -0L  10C 1  -L 0-LP@h *P TP~ 0 R00 0 0 R00 00h - L -LFϠL0 00 000 06 07 -@M̀L<0S 0<0 8P 0% 0*0P  8P  2P00S000 0|t 00 |i00008@,0! ꊄ@ -L@pP<0`S @4Sp0 <X` d0 <08<H@4SP@ G $ -L@p0P $2 W00 R0S -*04 P 0 08@P 0W00SO `P `08P VW,0#3S(08 Y0408̀`08 0>C0C0fSN`V08 X .08`0 k08D<"x -LP` 6 T08p0N@00cS0808 08H<4.P)<" 0-L@ MhP0UP00Km 6 06P6P 0- 0 T00 S ΠDD0! 0S   $<<0000 0T0 p-L@44PSp S P`44S0`0T P`V<Q 44S  P 00pS 0-@44LS6 <Q S  0S 0N8 0S44S  |0B l0=d 000P44S  040/ 00(PU0S 0-LP@0@Dt 0%80 S0x -LP`@P p<\@P<@.3' p-@<0LS x00  l`0d^< LP<)8 00eSpt<" -LP@`0p p#R 0#3S3S 0#3SW RO`VZ -AP0Lb0S\3S0S 0P ` @0 ,00= RO`VR?3@X (0!`p@0 0S0000 0S000C0 x0 \#00R0S 0RRO`VH !X ltR -Lp`@PT  R 0R S  $0T @$@4R P -L@$0@0\0声0 -L`@ M(@ f0!pP@1@0S2 @$@4R!000\0Q00\3S ( K10 0S @$@4R( KH10 0S @$@4R( KG^ PpW(@T XP LfPX !k0`` @@@@(@$@0P40(0S @$@4R \#p0<S2BCQ  P@<0P (0Sf !:#t$P00p00@`0 0S@0000@HROpW0S000 ! P<@0P( R  ,,0,0( Dtl| -L`0HM9e@P 0 T/eP  50 %eP eP epP eP  o5.00q0PpP;084!S000U0:PPU _?   R:0S5>00:0 0 @!@@0C` 0 $d(d(0,S U (,P 0S  @娸P@pB00hKS  R00 ,|p00 ]m?0 T0  ٨b?RORRPU: ###(`RQ $eeeee+ -La@0A @TU000P5~ 0 0xP  AP 0!1 A0!1t !l 01000@$D@M000t`-#)# -L p-L(`KMv@0 G0 001@T@P1S OG^ P@T@P1S 4{G^ P@T 0S00#t#p -L -LPph`0@PU?00 eP003cP0S00a -L`  pPM80 B@P0Y 0 R W ?00 wR0000 ``@U U UU UW Z 00 S00?S`w00S`V  , K00K4K,0h 100[040[ 0-0X 84( 1$  -@0 L0@D0S  000WC鏮! -LQ#\M * RR  <00? 0K \: K0 0ꏮ! -L$M, ?0 4 !@ 0 <0@ R 180 <0 R #0P ,#0,000\,0 0  00 8 4Q t 0RKσ 00! 00!0 0cS00!0SQ 0S0P,`U D <` 0PHPS RS  p `3pS 2S 2@0 Ÿ@ @ PE`@U JPT00T0SZ00  4PEu 0:S @ @PE`D0@2D0 U %PTT TU 1 0  U !`PU 00 W 00Cr4\ W4 T`s T T D0  D0 ("(@ D  !@ Xl 8!0@< 0DHT T VT SD MD0  FD Aꏮ!<"L`t\4\4 8!0,8!0@0  @ $@ 8!<@  -LpM@`SU3 2S0 0S- < 0` e@) KKP  0< ``L  P`h) [ 0 0G@VH@@gjP P0 R ( 00 -L000@鏮! -L`Px@pT 0S X  P @TfhPP0 00#0 -L`P @\3pS3$/,/4/90N0N@P0(0@`0@  0$ 0,0$D004< 0S S  $+ 00R"0S P 000S00B?0S @0S)@\ $?!|<P P@@00Tf0S 0P B?0S @ R9@0S04088K C?0ڽ`P B?0 S 8@0S00!BO0S 0X P<80/0YHP @0!`$r !</L<P N4@,DA Je8,,, ,8i@g<0 @, -0h3LS p-L`@4M0' 1S$LPK4(0E0K0 0   P000<8 000000:  00p -@0@LP P DX, -L@4M0p aVPPK40I0K~4 0   P000 -L 0-L0@$B0@P$0@ !0 -LP`p0!0 S @ 0S0000 `P Y 0 0``00 `F! -L0p`@P M00 ̀ 0!,  0  @        뀢 x0S0 @0L 00 P 0~ U 2  v@ r n j f d0S Q0S 0S:000@,@0`(`dh0p!<00 `000@,@0P(PTXP0@ #$0`!O04`@1 000@,0P(0@HLPDd.,,,,,,,,,,--- -@-<-4-H-\-p----000P,@P0@(D 0D00P Q , !0--- -L@B@M0`Sps T s ̀0 PUn 0cSaS00mc  X10S00 R 0@ 8PJ0SD10D1 0 000 0S S  00R WW  pb`KW08 08 R0(0S00傿 000000 -LP 00 R 0cS aS00 0000( p-L`PL@K44M@0F0K0E0KY0  E0[F [G0[ 80,AT,c0F qPB 0T@00) 0x`@T" @4F?0$D/ 0  3à0  @P @0x@40.0, x@,A.d.>YU!-0 1>0,1 -0:L  00,c 000c p-P4M L L@K400>F/ 0CE0KJKIKH K1 #4G0K 0 B0@0F0K! L@K400> Bpp@ 0 pppU2  0^? xBφppCφTT2TTB  ppp@ $$2$ŸP Ppp,ŸQ  : 001Aˠ0D1! Ppp Pppz 0 d͆ppk̆44144A  ppp@Z ?00 00AφppI D 0pp Iφ: 0#|/////`/!/ą/ %H/cb)#/ed#/g#f/0+00(Jφpp  0 -L -L@M`0 00SX 3S0 00 0T 0( 0100, 000WDR/P1S 20S >0S 0"110002  0C 6 6S 6S S 7S 6L"1n00p > 0"0S 0S S0100 > b0S^0S 01S 0" 0" 11q PU :0 Q R D g<18!4E?00$\2S  U0 0N0S 0EB/00^P ^0 R0 S Qv0w  0 0R000&0R000::S + 00l0YU!00--  -L@ 0-LP@ P P 0 R00 0` 00CS 0@@ P0 Q   000 p-L`+ oP ! 0 R00 0 00CS 0@x 0 0 `FQ   0`0P  @Pp00h - LP1 -L@00S R (0RG P#$ -L`gPH0Q0<  G \Z( 00P 1#$ $1 -L00 R000G PZ 00# $ -LL0Q <0R 4000G \Z 00#$1 $ -L< R 0<0S 0S R -L@\t0l P t 2Sq 2S r 2S~ 2S P -LM 0 -LQ ,0$ P ,0 S P p-L@` KM1[0P) 00S%SS 4 K [0[S [ KPEu 0[?S00K[ K|0[Sp 0-L@P 0P  R 0R: 0R 0"      @^0 p-LQ@@TPMD0SAD0S= `P 0DS KAT1[  T1[ %D0S0 K-1[08#801K![TT D0S=?0 T S @D@Qp p-L`Q P@ @PUp -LP`Q @!@3Tp`@`0 p`&@TZX < p-L`PQM @ K 1R@Tp -LP  -LP  -L0P 0 0-L@P?9P0 -L? -L@ KM1[ 08#81K![ -LP`M@PV7"pK k2[>;2K2[ S SC(B$B"B! S2(2K 2[S8V@ D2[V,"K002K"[j 0-L@P= KM 0[S 0C0K 0 [10   K0@00S@[0 -La`0Qd00S d00a  h0  Q^ (L  Q^ C -LP`ᆁ0f`pMQd00S d 0a  h@0  Q\   Q\ d0P !0f 0< 80 P 0S d0 00`@<282@υ0f01 0-LP@{@T0 -LP`@M P@T+!0dh0``p 08 40 Pd0 0S d0 00`<282?0 d8 00W@TJ=@TZ1 -L0 r 2R r 2R r 2R  r 2R0, 0# 0S0S0S -L`p @P PP PPp4` -L\0\p PP0 P@`T P`@T p-P`` 0 000@LT 40S0S 040@Tp -L䐟0SM= pK, h`K"2PK"2@K/  0 l llZ4 ,0 Lp H` DP @@ 0 T P D0D0<0 T K0 144K ('@2P2d2|222222 p-H`L@P@T 0S QP p -L@8 0000@ @  0-L\@ P0S @PUZ0 0-P40LS 0S 040 0@ 0@@ 0 0@@ X0 -4LP , h001 P -L@0!000! -L @0!000 ! -L @0!000 ! -L @0!000 ! -L("( @0!000 ! -L @0!000 ! -L@ KM1[01K![ p-PL0@SM$  `K { [0R:    j [0R / k2p 0-L@MPP  KZ1[01K![0 -L@ KMG1[ 08#81K![m -L< -L -L  0l LP 00S  -L0 S@pMg*c \ P1`,K ? 0 F0 K, >0q00Q  RA,0s, ,  P0 6 ,000,0 0 P P0 * ,000,0 0 00 00,0 ,,, 00 0,00S ,0S 00 00 S:W/ , K?1p1 0 K, ,0A_s0,0 0Qq ,@ ZP0 ,00r< 0,0>000 00$3 -M`LV 20 h0P 0 0 ډ. 0! P) K pE* KA)0[* [T D0S 0, K@2. K<2["[XHU00U0S $6) [6P0 ,  0K $p#"2K 3[[0H XU00R0S $**0< 0P $ (p& 3[#[X H0S(8 K,< K80S<0S @\3x3U00U0S 3D#[?6CP0 ,  -L|A@P |v 0  0 0  0  p-L@`P 0 0 `@000040Π>P 0?0= 0@00^p -L`pP( KM0@\T6 " K d ` @(0= 40> ?4 8 (0 X`` ?`{"[@X0< U33 0-L@=PK M20[S < +0[X00 -L@hM  10<  -D"2( K-0D000\##(,  \ 3\ 00R: 0 ,( .0R*08 ^&l0R @( B*  333  00,084 p-LP KMP R00r``V (0R r ?@P/[![<0"(]Pn@@p -L`PMpT pV%0[`0 @00 @  0 X 0p0 0W% KMP%0[000W@T -LPKM>`40@R 2 B @TwAp@T D000CS 0`@TpW p-LP@`T <0S P p@Tp 0-L@PPP &0 000P 0>@<@ $00x p-L`P@P 4P0`?p -L P 40S 0S   -L P 40S 0S   -L P 40S 0S   -LP ` @pT P@T@PT DP@T -LP ` @pT @T@PT D@T p-LP@`T D@T @ PT @Tp p-LHP0@`T 0Pi0@Tpx p-PP  㫸@?@PP`p* @ D0@@00 -p PL0S0RQ>`P  ⿾@T@ U  %0   R 0``w>` p-LP@0 `   R  ᣾ 0 0000X>p p-LP`0!%@ R0s  BR0S Q0X0 U 0 0000->0S!#>p4 -Lp$ML 0!\( P 0U*00S  @8#8S@D(@D$@D"@D!@D 0S): 0PP:\ CP$ZH@K }]?P0DP 08@K@`E ! b0 0L 00 ! -L0! P Q:00Q: P! -LP@MpP Q 0@%4 ``@T00Â0BD  V  `0!XD0D @R  ! 0-L8P0?@T @T m0 0-L@P ,aPP000S T?@P 0S R@U04 0-L44PG;(@ 0b 0]056 0-L@@PK MA 0gX 8@ 0g0 -L,0 ,S)\ 0S(0S x0     ,0D0S`0S  80 T0< XR ? 0T7 -L 00 $ p-L@P0`S 0S 2R <0#R  2R 0#R 0Sp 0-LP@  0| -0LP -L @`p!X 0@U0<00 00 P -L @ x!h("X 0@U0<00 00 P 0-LP@H0P  N0 0-LP@80P  J0 0-LP@(0P  L0 0-L@P0P  N0 0-LP8#H0P  J0 0-LP@0P  N0 0-L_M 2R Q d2'@Qڰ 2R @AQʴ" 2!$8<80 0߹0 R ׹X8`80 -L(0 0S0 UQ W!W! -LP ` @pT P @T@PT D@T -LP p @T `P @T@PT X DD`P < 00S0(r$pV@T`Y!$?`? 0-L@PP 0 -L@P 0\Y! -L 0-LS S S P@ 00@PPL@P0U T 000 -L`M?80 0@ 14!640 <0 R00S@ 0RS T030#YZ! 0SA 0 Pp  0p3WKZ00S ) K) [0 `@PJ00SU , K2[0#4 0`@PE 4 K 400`@PEUU . K0"[ "$ `@PEU / K /0[0@ 8 0@ -L@0P0`p41V4W U\X  K? K  10<  q[( P j"[e$0[/`X R Z0[S0[S0[S2 dN0[S  LG@@  0S*  # 00 0 0[S  -0[S  & 0Q05 3 702 05\@p@@ ^2   0*t t0t 0S S S HD?? @(@8@H@X@p@@@@@@@@@@$  0@@@pWZ@@ -LY! -LY! -LpMP, \,  0AT"  0!000     0 `S` 08` 2P  0 80ꤤX -LP`1f1\0@ M :H  0Cqzp 0P 0   0`P ?00 A -L`P@M?!p&0 <0R3 `P/ T T T  K  K$ K``PT T #T [[$`T T T Ьլܬ -L@`P?p0<0P P%/  R0P U U !U r@P {r@P!(~s@P P@@@ - L00 0Z! - 0L 0000 -LT`@p@T PD P`V P`Z! p-L@`PPPPUp Q 0!00C0! 000p -L@pM`, W:0 S:U L 0R RQ L3Q R Q0Q$3 3Q0R  R $R ( R RQ 2Q R QQl 0QR  R! $R ( 0U ^s" ^P 1P ^ PP 1P^  ^d $^ ( 0P P P0\ \ R 0R \  RQ0R0 0R0Pt\0 \ PCCQQQQQQQQ\0\ \ R 3R \  RR0Rp3 l3R0P4\1 \ \0 S S R 2R S  RY R" 2R  P P 00S{ R0 ,8  080P40  P P0\ \ R 1R \  RQ0R1 1R0Pp\0 \ \0\ \ R 0R \  RR0R0 0R0P=\1 \ \0 S S R 0RRRRRRRRRYYYYYYYYQQQQQQQQS  RY R# 3R  P0 0S 0 P PQ @3Q P Q0Q3 3Q0P P$P( P PQ 2Q P QQh 0QP P!$P( 0P P P0\ \ R l1R \  RQ0RD1 @1R0Pt\0 \ \0\ \ R 0R \  RR0R0 0R0PA\1 \ YYYYYYQQQQQQQQRRRRRRRR\0 S S R t3R S  RY RL# H3R  PP PU  0R RQ 3Q R Q0Q2 2Q0R  R $R ( R RQ H2Q R QQ  0QR  R! $R ( 0P P P0\ \ R 1R \  RQ0R0 0R0Pu\0 \ \0\ \ R \0R\ RR0R00YYYYYYYYQQQQQQQQRRRR3R0P4\1 \ \0 S S R 2R S  RY R`" \2R  P0 0S080 8 00 0 R'0 R,0r00 02 000000P PQ 1Q P Q0Q|1 x1Q0P  P8 $P ( R RQ 0Q R QQ 0QR  ,R$! $#4 0d 0, 240 D0,2 'RRRRYYYYYYYYDCR (p$ 01 XD -`p 0 LP 10 PP P01@T$@ヤX000* B0S SS$0 @0X:$0 40#40$0 40#40$0 40#40$ 0 4 0#4 0$0 40#40$0 40#400S SS0 S$0  $0 $ 0X@P0 4 8<#$0 #(#< 0$ 0X 0R RQ $1Q R Q0Q0 0Q0R  R $R ( R RQ l0Q R QQD 0QR   DR! $R ( -L$GZ! -PH`L0<S Q$0 0$0  0 0$ X 0U ^㐣" ^P 2P ^ PPŸ 2P^  ^x $^ (/@P@p0 噣!R RRpW01S000CS ^=00 4 8<#$ #(0 #<0$ "$ @00pW `0  d0 h ;0000pW0L0U 0 P㒣, PR 0R P RR 0RP  P! $P ( DE4EZ! -LMH@`$0 0r3/P/ ㇢0㌐0000$0 00(0/P,$B$ 0PU51 $ 0(,"40  0  S 500Q$00S#, 0$00S#, 0!$00Q",0 100Q$ P0l&UV ( ,a/_/0hEEE(0PU @,0 Pj(0 @U00d ddddd@dPd`dpd}0C08 DHpx|@P`pL0 0 Fhh-h/09A4CZ! -L@ML0 `P@H pP 4 ᧤PL40Pp#D 00Y02<0 0h0 L@PP040C3101bT0 LT 0@`PKHK 銡=?0D0 H0K8Kh ` 0`K @P`KR00bphHP R R |3R R  RRT P3RD30d0d0 80000Sl884 0R RQ 2Q R Q0Q2 2Q0R  Rx $R ( 0R RQ ,2Q R Qp0Q2 2Q0Rp  R $R (0 000d1d 00cS~ 0R RQ H1Q R Q0Q 1 1Q0R  R $R ( 0R RQ x0Q R Qp0QP0 L0Q0Rp  ꀀ<" 8"ppppppppR $R (00P#00CS00S )(#00CS00S =?00S B0000S @S HS@@ 0 SF`   R RQ 02Q R QQ 0QRo R~  0R RQ 1Q R Qp0Q1 1Q0Rp  R4 $R (000S @S HS@@ 0 S< R RQ p0Q R QQH 0QR  pp(8"DFh 8"ppppppR! $R (00>2d00cSx"00CS00S 3Pp<"00CS00S $ =?00S =?0 @8K!00CS00S 8K5\ T0`Qm 00 0R RQ P1Q R Q0Q(1 $1Q0R  R $R ( 0R RQ 0Q R Qp0Qp0 l0Q0Rp  R, $<"(8"|FhppppppppR ( R 00CS00S pW T0h@PLT   0@h@ 0\L 00 P00Y(8" -LHMP@HSP $P`p`L0 0 @T P4@ sX dF02P<0\` 0p0 HKT\ L`0A00cS0! `0 h Ha=?0D0 H0K8K\p0@0 @$ Pl0 p`0 \43 0c `d  P Ql  3l Q l P Q0l0  Qlßl  d3lQl T30dL0000S񟗗  0R RQ 2Q R Qp0Q2 2Q0Rp  R $R (000S @S HS@@l 0SX 10 0cS)!00CS00S ~0S S (S @@(!00CS00S T;=?00Sa <_=?0 @8KO 00CS00S 9(8KeE<0S  0R RQ L0QRQ 0ꀀ<" 8"pppppppp(8"FhQ@3 <3Q0R  R $R (p00`Ȓ00CS00S ɛ=?00S ʳŸ000pdWG<0S  0R RQ 02Q R Qp0Q2 2Q0Rp  R $R (0000CS00S pF@0S @S HS@@l0S`Ρ@ R RQ 4Q R 0SS SR  R! $(8"h 8"ppppppppGR (`pW-0Sh d0h   Shd0 h $S <0S hd0 h (0`p W 0R RQ 3Q R Q0Ql3 h3Q0R  R( $R (00"00CS00S (2?Bs =?0 iꝚ=?00S "000|20p20S =?0 @8K⡷4"00CS00S z8Kⷷ202!0000S @S HS@@l 0S l10 0cS 0R RQ 81Q R QP0Q1 1Q0RP  R $R ( 0R RQ 0Q R Qp0QX0 T0Q0Rd p (8"h 8"<"PPPPPPPPppppppppRd $Rd (00<0S 0#00CS00S ٍ 吿@L"00CS00S ˍ岙=?00S p"000W( 0BS(0( W(00(0<0S 000CP P R 42R P  R0R 2 2R00MP P R 1R P  RR 1R03P P R |1R P  RRT P1R0P P R 1R P  R R 0R  0R RQ 0Q R QP0Q0 0Q0RP  #RT $pp(8"LGh 8" PPPPPPPPR ( 0R RQ H1Q R Qp0Q 1 1Q0Rd p Rd $Rd ( ㏱ 00CS00S 0 S S R \0R S  R R4  00R  @@pppppppp(8" \ 00CS00S @T;\0``0\0 000L P f40\`L 6c pX0p X 00\@ P LQ,(8" M-L M@ < 0 0 4 P W&x0P  @4 Q8 e*800! 0P UW Z+  @T*0  PI $A  j G,0K00 H, <P@ < H0RE0jPc`p00c0  ,KH, <0P@ 0<0 -00c0R(`p 0B R 0" 0,84\8 :Z  @ 0,KPH,0< @  < 0S<@ $ -LHML 匠 H0P0 ,@Qd@ L00S3(` Y d@0Q: `00S`0  0Q*`@@D0!`@ d0L@00C`0S@ d0 `  R`  0S*`0d 0C`0 01L00C  P `@ 40QX 0C@\@ T  02<00p0 HK Hp唘=?0D0 H0K8Kh  l p@TP0` l  P R0 |3R P  R@l@  RTl  L3R0l0 @30d@80000S{ 0R RQ 2Q R Qp0Q2 2Q0R p  R | $R  (000S  PS  XS PPl 0S< 100cS !00CS00S u!00CS00S d嘖=?00S} {=?0 @8K⬳!00CS00S 녮8K³a<0S  0R RQ 0Q R QP0Q0 |0Q0R P  R < $ꀀ<" 8"pppppppp(8"GhPPPPPPPPR  ( 0R RQ h3Q R Q 0Q@3 <3Q0R   R  $R  ( 0R RQ 2Q R Q0Q2 2Q0R   R D $R  (00"00CS00S ݉d㔭00010}N0S =?0 @8Kֲ!00CS00S 믭8Kl10}Nd!0000S  PS  XS PPl0S 000cSo 0R RQ 0Q R Qp0Qx0 t0Q0R p  R 4 $ (8"<" 8"ppppppppR  (000S  S  (S  <0S |#00CS00S "hL#00CS00S (=?00S #0003<0S  0R RQ 2Q R Qp0Q2 2Q0R p  R L $R  (000S  PS  XS PP0Q Q R 1R Q  R:0Rd1 `1R0 @ Q Q R 4R   Q 0S S( S($U 0SC 153@Q & 0R RQ 0Q R QP0Q\0 X0Q0R P  G(8"h 8"pppppppp::::::::HPPPPPPPPR  $R  ( 0R RQ D1Q R Qp0Q1 1Q0R p  R  $R  (000S / 㨹( & h  Brh  \ ᜹T0 00d@D 00CS00S ԇPPppppppppHHHH<"(8" 0~ ㊬!00CS00S YB`0d@TP PQp`@T 4Hd 0P6 X  fX י`0T@U04H`0 T pP \@0p 00@\@ TXQ$L0L@ 0$0R LH(8" -LD@K  M0H壔=?0@0 4K00 pW5T@ 0000S S 0 00x 00CS00S I4PKP`8 00CS00S 9(e 8"(8"0@pZ00WpW"J02T `<0@dP0000 S 0 0߫00CS000S 0`F0@DpW 8"Z -L`P \10 0cS h!00CS00S 1Dx0!00CS00S # =?00S} {=?0 @8K 00CS00S 8K4l00a<0S  0R RQ L0QRQ `0<" 8"pppppppp(8" Ih``Q$3 3Q0R`  R $R ( R RQ 2Q R Q Qt p2QR  R! $R (00b00CS00S d8000!0Ƞ0 0cSo 0R RQ 1Q R Qp0Q\1 X1Q0Rp  R $R (000S S (S |ڶ<0S < 00CS00S ````````(8" 8"<"ppppppppTI00CS00S =?00S t0000S @S H S@h 8"@` 0ST@@<0S  ሩ 00CS00S PLX  0T X 4 PcX0P 32 X dT\ 0d 00 \ RP0S(8" -L$MpHP@4` ᶔ0FDHKS 0崑=?0D0 H0K8K l100cS x!00CS00S T㝵{@!00CS00S ك =?00S} {=?0 `8KԬ 00CS00S 뭧8K|00a<0S  0R RQ \0QRQ`0Q00<" 8"pppppppp(8"Ih````$3Q0R`  R $R ( 0R RQ 2Q R Q0Qt2 p2Q0R  R0 $R (0000CS00S 4d!000!0P!00cSo 0R RQ 1Q R Qp0Q\1 X1Q0Rp  R $R (000S S (S |፴<0S < 00CS00S ÂY``````(8" 8"<"ppppppppI00CS00S 哎=?00S t 0000S `S h S`h 8"`L 0ST@@<0S  ;, 00CS00S h(8" -0LH00pX<!0000S 0 00 S  00CS00S B0pX00WX" pW J02T `<0@lP0000 S 0 000CS000S 0`F0@DpWZ 8"(8" -@HPL00XOTp<`41   0 S6 R RQ 0Q R QQ 0QR  R! $R ( 00咦H 00CS00S 0p0`00X 8"(8" -0H@LGE - MH L,  0S<000 OQ$0 0,$0  0DU00 ^#" ^P x3P ^ PPTß P3P^   ^  $^ (0 0R!  R R p0 0R!  R R ` (0, 0U 0 ^#" ^P 1P ^ PP 1P^   ^  $^ (,X1 ,0 ^#" ^P 1P ^ PP 0P^   ^  $^ (,0 ,0 ^#" ^P \0P^PUP4ꘘ0JUUUUU`3P^ U  ^0  $^ (,3 ,0 ^#" ^P 2P ^ PPŸ 2P^   ^d  $^ (0S0  S0 S0 , 0(000S  S S 4x!,S, ʀ ` ƱYW,  0U ,0 ^#" ^P 1P ^ PP 0P^   ^  $^ (0 0R!  R R  UUUUUUU01hJP=, $00S8`,0$ 0P/@P` p4 a 0 4 8<0#$ #( #<0,0  $ !4 0!8!0,$ 40P,  Q Q Q 1,!1,0 0R|10 |1, 0 p1,`!0 \b,00P, $00` 3 0,$00d 3 0$00h  000P0L0, U00 P. PR 0R P RRx t0RP    P 0  $JU TUJZ!P  (  -HPL$0 0r@PßP0L0 S T4凰20㌠0000$0S 0 4 8<#4 0 0P 00`(0P,^$ 0V51 $ 0(,"40 H 0  S 500Q$00#, 0$00#, 0!$00",0 100Q$ 0l&^V  O0SSS(0Sh1 $ 0 48<<<1<180818!D0H ,/0S 00(0S,0P0CSRRRRRRRRRRRRRRRR0\0`0 000x  L0 T ,P $0KK,K8KhKKuXShKLUHTZ! -L4ML0 P@P P H4 pL04 S0"D0l 00Wi02<0 0\0 L040C310bL0@PKHK  m?`H0KD` 8K|0\Pt@000\ 008Kⶦ 00CS00S }돡8K̦ 0<" 8"P X P 0 R 00CS00S } p\0@L 00\0 0 \L 00 00W -LNS8MT@ L0 @H0P 0 00T R02T0L 00C1 0`K HK0lL X ym?`H0KD` 8Kx0HppS0000S 00 8K6 00CS00S }8KL00  0`` K `0Kh"\ \P 2P \ PP 2P\ \!$\( 00^2" ^P 1P ^ PUP 1P^U  ^ $^ ( 00^2" ^P 01P ^ PP  1P^  ^ $^ (` X0 00^2" ^P 40P^PP  <" 8"UUUUUUUU2P^  ^T $^ ( 00^2" ^P 1P ^ PUP 1P^U  ^ $^ ( 00^2" ^P 01P ^ PP  1P^  ^ $^ ( 00\2" \P\P P \ \ !$ ꪪUUUUUUUU\(  d 00CS00S {00XTL  00T X0 R0L 0 PT 00R((8" -LPH@K,MT  L0 H坈m?`D` 8KX000@T 00p8@K] 3 0ß0CS00S E{4q0 00<0S Q.  \ \P x2P \ PPP L2P\ \!$\( 0\2" \P 1P \ PP 1P\ \!$\( 0^2" ^P 1P ^ PUP 0P^U  ^ $^ ( 0^2" ^P 40P^PP  <" 8"UUUUUUUUt3P^  ^D $^ (0SL   SL0 !$SL (Ÿ00CS00S ?z$2?Bs =?0  =?00S <000pQ Q R 2R Q  R@pRq 1Rpp`Q Q R 1R Q  R `Ra 1R``|! QP  @Q HQ@@0SF SL SS W=?00S 00CS00S y 000塅0S @S HS@ ꠠ(8"h 8"@@@@@@@@ <"h@0S S S 0R 0S P00cS 0R 0Ss0S @S HS@@0S S S 0RR0P PQ 0Q P Q0Q|0 x0Q0P  P<$P(宪 <"PLL奪 00寝 00CS00S x<0S T <0S  00叝, 00CS00S xTM(8" -LS$M8 PHp`40 1 4@ Ԉ< dF0< @` D H  LD `,K @0 @f 008pT 40pP4 0@ 0T0S2[ S,0D < < P8 @0@ 00 40 1  <080<0 00<@ P 0S 0^㐓" ^P x3P ^ PPTß P3P^  ^ $^ (0^㐓" ^P 2P ^ PUPŸ 2P^U  ^` $^ (0^㐓" ^P 2P ^ P P 1P^   ^ $^ ( 4Q:<02<0@R0 R0 R* 0@ ,P8 j 0Se  0R RQ 0Q R Q0Q0 0Q0R  Rt $R (0 S SQꪪUUUUUUUU SQ Q S  S! $S (80@@   404@ b04  0S[ R8 RQ 38Q R QQX T38QR  R! $R ( R R0SR0S S R  R! $R (<0@< 00 @ QD 0 HR @0^㐓" ^P 1P ^ PP 1P^  ^| $^ (0^㐓" ^P ,1P ^ PUP 1P^U  ^ $^ (0^㐓" ^P x0P ^ P PT P0P^   ꐐUUUUUUUU ^ $^ ( 4P_*0SX  0R RQ (2Q R Q0Q2 1Q0R  R $R ( R R0SR0S S R  R! $R ( 40B= p0< <₠ "40`KL4 @ 4@p 4 0p Br4 0@0S3[ S00<@  < P8   000 -LPML 匠 H0P0 ,@Qd@ L0S#(` Y d 0Q:`00S`0  0Q*`@d@D0! `@ L@00C`0S@ d0 `  R`  0S*`0dL0C`0 010 0C P `@ 40QX 0C@\@ T  02<00x0 HKxsh 0H p ?]?PH0KDP 8KTC000h`V 00`8K 00CS00S tט8K0h 00T0p<0S p@h 0\2" \P t2P \ PPP L2P\  \ !$\ (php 0^2" ^P 1P ^ PUP 1P^ U  ^T  $^ (p0h@p 0^2" ^P 0P ^ PP 0P^   ^  $^ (p0h@p 0^2" ^P 0P<" 8"UUUUUUUU^ PPhß d3P^   ^4  $^ (p0h@p 0^2" ^P 2P ^ PUPŸ 2P^ U  ^h  $^ ( 0R Rp0Q 2Q R p@Q00Q1 1Q0R 0  R  $R  (t |a0Q}>l0 @t  Qp R@ t  <1R Q p0 R@@t@  Rt  1R0t0 Q Qp R 0R Q p R R㬐 0RQ  P!Q  XQ PUUUUUUUU00000000<"@@@@@@@@ P0S  @S  HS @@t 0R 0 S 0l 0cS00CS00S r㰖\ß000h0S =?0 `8K00CS00S r啤˖8K200l0 000t` 0P00CS00S r~=?00S d"0000S  PS  XS PP0S  @S  HS @@`cVt0 0R 0 S0S  PS  XS PP0S  @S  HS @@t  0R 0 S `0l00cS,t 0R 0 Sv0S   P(8" 8"M<"hS  XS PP0S  @S  HS @@ 0RH堣W0P Pp Q 1Q P p0Q0Q0 0Q0h@P   P $P (k"|h h00q\ 00CS00S q<0S MN|N(8"<0S  h00I!00CS00S vqYP@`dT PQp`P0 T 4Hៃ dX 0P6 fX 啃`T U2(` T x0P@\00x0 00\ \X^2L 0$0R L(8" -LLML 0P LP0CH T PL 0ST 40Q\ 0à@` X  02<00t0 HKt匃d 0H0 l0 =~m?`H0KD` 8KTC000dpW 00p8K 00CS00S pՔ8K0d 00X<0S l0dl 0\2" \P p2P \ PPL H2P\ \!$\(ld 0^2" ^P 1P ^ PUP 1P^U  ^T $^ (l0dl 0^2" ^P 0P ^ PP 0P^  ^ $^ (l0dl 0^2" ^P 0P<" 8"UUUUUUUU^ PPß 3P^  ^X $^ (l0dl 0^2" ^P 2P ^ PUPŸ 2P^U  ^ $^ ( 0R Rl0Q @2Q R lQ00Q2 2Q0R0  R $R (p q0Q}>h0  Ql0 R@p  h1RQl R@p R8!p  01R0p0 Q Ql0 R 1R Q l R RԐ 0RQ `Q hQ``0S @!UUUUUUUU00000000<"@@@@@@@@ S HS@@p 0R 0 S 0h0cS00CS00S n㯒`000d 0S =?0 d0p8K00CS00S n哠ɒ8K200h0 Ÿ000pp 0P00CS00S nz=?00S d0000S `S hS``0S @S HS@@pcWp 0R 0 S0S `S hS``0S @S HS@@p0 0R 0 S `0h0 0cS+p 0R 0 Sv0S  `(8" 8"M<"hS hS``0S @S HS@@ 0RH垟W0P Pl Q 1Q P l0Q0Q0 0Q0dP  P$P(i"|f d00o\ 00CS00S m<0S  MN|N(8"<0S  0dd0F 00CS00S smP#LXT 0\X 4 c\ 1 X t`0t 00` Q\ RGP0P 0$0R P(8" -L@4ML P0HSP L0 0R eHK P圃X0 P0Qp QP R@\  d1RQP0 R@\ R4\  ,1R0\0 Q QP R 0R Q P0 R RА 0RQ `Q hQ``0S @ ꪪUUUUUUUU<"@@@@@@@@ S HS@@\  0R 0 S 0X0cS00CS00S k׎l000T0S =?0 8K00CS00S k 弜8K/200X0 "000\0 0P00CS00S jv=?00S ЎtŸ0000S `S hS``0S @S HS@@cX\ 0R 0 S0S `S hS``0S @S HS@@\ 0R 0 S p0X00cS,\0 0R\ 0 S70P P PQ 0Q(8" 8"\M<"hP PQ0Q0 0Q0TP  P$P(0T T 0؎X 00CS00S j4弛<0S @(8"xM<0S  T00導X 00CS00S i@TL 0$0R L(8" -LD@K  M0Hv=?0@0 4K00 pW5T@ 0000S S 0 00x 00CS00S i4PKᦒ`8 00CS00S i~Ồ 8"(8"0@pZ00WpW"J02T `<0@dP0000 S 0 0500CS000S bi0`F0@DpW 8"Z -0LH00pX<!0000S 0 00 S  00CS00S :i0pX00WX" pW J02T `<0@lP0000 S 0 000CS000S i0`F0@DpWZ 8"(8" -@HPL00XOTp<`41   0 S400P PQ 0Q P Q0Q0 0Q0P  P$P( ㍍TzP 00CS00S h0p0`00X 8"N(8" 0-@0HPL<$:8,60 -PH`L0<SQ$0 0$0  0 X  U0^㐣" ^P 03P ^ PP ß 3P^  ^ $^ (Z@Pp0 噣!R RRpW01S000CS ޙ0 4 8<#$ #(0 #<00$ "$ 40#40 p廙@00pW$0` 030$00d 30$0p0h @ 00000W0L0 U0 P㒣, PR 0R P RR 0RP  P! $P ( 阘O$O\O[! -LMH@$0 0bpPpIt0㌀0000$0 00(0P,1$ 0 PU51 $ 0(,"40  0  S 500Q $00S#, 0$00S#, 0!$00Q",0 100Q$ P0垬*UZ  U(0PU `,0 P(0 `U0 80D 40S 80S0 <0@ $00S ɘ0Ř0H0 @P`00\ `x|@PL`0 0!OOODPt@tlPPp  H [!W ,P sqo$m -L`PpH@K Ms=?0 8KD0 P`\0lPH` \ R 03R \  RR 3R20d@0S񟗨$0ddijijijijijijijijijijijij$ 0R RQ x2Q R Qp0QP2 L2Q0Rp  R  $R (000S S S 0 S3 R RQ @1Q R QQ 0QR  R! $R (00*000cS 㲗&xq=?00ST ߉R=?0 @8KՉ Bꀀ<"ppppppppPh0  00 -L`P M0匐@RH Q  040P-004@ up$EX 00W02<0 P040C310Ab@ 0@P  0Pp0X00 00W -LP@MpH p84 u`40WD( 02<00 @V!04 0C320RaP0S00CS004  0`pW 00 @VP -L@ML0 `P@H pP 4 duPL40Pp#D 00Y02<0 0h0 L@PP040C3101bT0 LT 0@`PKHK Gr=?0D0 H0K8Kh ` 0`K @P`KR00bphHP R R 3R R  RRd `3RT30d0d0 0S((`0S 0  0R RQ 2Q R Q0Q2 2Q0R  RL $R ( 0R RQ 2Q R Qp0Q1 1Q0Rp  R $R (0 000<1d00cSw 0R RQ 1Q R Q0Q0 0Q0R  R $R ( 0R RQ L0QRQp0Q 0ꀀ<"ppppppppА3Q0Rp  R\ $R (00$p 㖕oo=?00S ć0S @S HS@@ 0 S[ `  R RQ P2Q R QQ( 0QRo Ru  0R RQ 1Q R Qp0Q1 1Q0Rp  R\ $R (000S @S HS@@ 0 S: R RQ 0Q R QQh 0QR  R ! $ ppppppQhppR (00!2d0 0cS p㷔n=?00S =?0 @8Kۆ8K\ T0`Pl 00 0R RQ L1Q R Q0Q$1 1Q0R  R $R ( 0R RQ 0Q R Qp0Ql0 h0Q0Rp  R( $<"PhppppppppR ( 6pWT h0@LPT 00h0 0 PULP 00 P00Y1 -L0 U00^2" ^P 0P ^ PP| x0P^  ^< $^ (X R <"P 0 T4# @X QX   0nS000P0`d  @X00 Sd \ oLX b -LM`HP@ @p 000 00̠> 001 9XQ -M`HLP@ @p 000 0000< 00  XQ -L`PH@K4MX T \ Hp L0 }n=?08KD0 0`\\  \ R \  3R \  R0 Rlß\  d3R0\0 X30d0P0 0S~L00 0R RQ 3Q R Qp0Q2 2Q0Rp  R $R (000S @S HS@@\0S4 1P 00cSrl=?00S Y 0 0   0R RQ d1Q R Q0Q<1 81Q0R  R $R ( 0R RQ 0Q R Qp0Qd0 `0Q0Rp  R  $ꀀ<"ppppppppQhR (0 000vX3P0 0cSh 0R RQ 3Q R Q0Q2 2Q0R  R $R ( 0R RQ h2Q R Qp0Q@2 <2Q0Rp  R $R (00k=?00S 0S @S HS@@\0Si T  =?0 @8K❈뀃 Ὀk<0S  0R RQ 0Q R Q@0Qx0 t0Q0R@  R4 $<"ppppppppQh@@@@@@@@R (0SL0  SL !$SL (00$3?Bs =?0 ؂ k=?00S P3020P0 0S =?0 8K8K4300S @S HS@@\ 0S |2P0 0cS 00<0S DX 刐0j=?00S Z$ 0BS$0$ Z$00$0000CP P R 1R P  R0R1 1R0o 0P PQ \1Q P QP0Q41 01Q0PP  P $P ( 0R RQ 0Q R Qp0Q|0 x0Q0Rp  R8 $ꭋh<"RhPPPPPPPPppppppppR ( X T0Sj 00 0R RQ `1Q R Q0Q81 41Q0R  R $R ( 0R RQ 0Q R Qp0Q0 |0Q0Rp  R< $R ( pppppppp<0S T |X -LpSM⌀0H`P< <4@ m0DE CE l P0 K00AqW pW00K P  0P0P00K 0P0S3[ Sz00< < Pq0@00<4043 00 @Yf  W-:02<<0 PR0 R0 RL 0 PF0@  < 40pb43 0P00 @Y1 W*00C1 PpGw pG0w P80K 0Q80K  0Q0S3[ S 80<< P  000 -LdMP `PHSX $X@pT0 0 P\ = X4@ l` 0DGd@  C# 0d@TT@!P 0PPdX Td 40 dT 0 `` 00dP P   TQ`@X02<0 00 \dT@0@00cSh0 0b0h0 HKp H0 t0 i=?0D0 H0K8K@|@ x@ @ $ d@0 \l 43 0c   \P  3P \ P  Pp#  h3P00 \30dPl@0S񟗁T 0R RQ 3Q R Qp0Q2 2Q0Rp  R $R (l000S pS xSpp0S7 100cS坍P g=?00S tQ 0 0  0R RQ d1Q R Q0Q<1 81Q0R  R $R ( 0R RQ 0Q R Qp0Qd0 `0Q0Rp  R  $ꀀ<"pppppppp1o $ $ $ -L`pP@\ U \! 0T 0#22w00!0V0!0\ RU0\0\! -LB`0| ^ H0*0"2,< S: w< 8#(L|\! -Lp0W00X 0p`0!l$h0 @@00 PP0@000P0! $ $ $ $ 0-LP 0@R ^T T 0T 01!0 0b0C0 !, l4< 00!0@!0 0b0 !, 4< 00!100CS0RRpRR@R0 , R0BB B y00 0,0B R B m0p0, h0T00, C S C]0, X00, R0 $ $ $# -L8 80000 0 S 1J $ $ $ -L@0D D^0 0#10 0#10 0#10 -D0L0 "S00@T 1P  $ $ p-82L@`TE00!ŸR0$000000!0@0000@@000000000000000000000000000 0000 41@0 000!A !00 0 00 B00  00 00 0C0 /00 90C00 00 hl 00 00 0C0 0C00, 0 4 00!p $$ $ $ p-L00! !  A Q00$00000``00000000000000000000 0000 00 0`000!p$ $ $ -L$0$ 0Q000 p-LP@Q t0 @T =a0S @a0S @p0@p00"S0@p 0@p0 @p p p0@p0 @p 0< 0p000"SD0@p $ $ $ $ $ -L<2M0@ S,2p0`08# 00,0 T PV1P00!!0P000 P0C0000P0P00!W  p00 R P00 RV JW, 00 R 00 R00!0@W00000@00 00@0 00 0C0,001 h0V- X0Q  H0RV ;2 $ $ !\!@  $#kb>PV4`08 0000040 0000! - !L0ZA 11 MA00!@P0pp00 ``0 00! <S7  00!0p00`0 00000! >0H$## $ $ -0L0@S0S0S  R R R  P0 SL 000@ 00S<<P0  % $$ $ -LpQM, 0/ < @04 `(0 0\`` $ $$\!`PehPM 0,@0e0h$GM0j T@TM000P 0 0b0 !, (4< 00! $ $ -00LSx00S l00SX0  b0! 80 00!0  $# $ $ $$\! -PL0S< 00, 000$00S F\! $ -LQP@`0R1pW  0R M10S 0V*T 0儀!1 0 R :xA  fF0d!00c000A0 q00f"' Aq " 10 fR*@0 fcmF0 0b0p Aq0 002 Aq0 0x00 0 c 0!< 0L$,00 !0 0h00 $ $ $ $$\! $ -L -LPpW00@` T0!S 0S 0 T0RP@D W00T0#SUPEPW00$,l$ -HMLpp0 `0@Z H1S9V6l@K  X0@TS$ 0u@RQpeW =?0H! 0003 S  GpW $p 0@ -HMLpp0 `90@Z H1S?V<l@K  X0@VU* 0u@RQpeW @=?0H! 0003 S  "H@$Fpd p 0@W  -L @KMQh4l -L`@CMP# q@Xk FFT0@  K0@K @T 0  003SKIoK  @PrD=?0 0  003S`=?0 0  003S@K sG`@KEV @@K 0`=?0 0  003S@K TG`@KEV @@K 0@m?` 0  003SK 5G@KETh 0S0SP Kq   @P $ 0  003S  ,F\ }@m?` 0  003SKK F@{ET+,1C>P:H! 0 003 S  F\ Q@=?0 0  003SKoK F@OET :,1?S6P 1St 1S',P @H@@B>T1S S$$$0S   0p$ -@M00LPXL14qQ@P*fXM (0S  090Ad@K  TP 0 00V:`aAOK 0S"40  :#:0>00  C0S `&6400Ɍ 00P $ -LQ 4 BR4040 h$X000S 00 0p,@Kd 0O@ P0PP0P @P x $$$S$RXpa0S x|@xA0 |A0@0C0S$$$ -LP`p0@S9 P P P P V000 000(   0S0  0S 0  P W  Pp@Pc  -Lp0Qca 0@l0nT@!T@P% P Pl  `PA A A0S Q  A]?P0厠 0  003S0` mDT B 0 0  003 S \DT B0 0  003 S KDT BPJ \G  0  003S  6DT: B]?P0匠 0  003S0` AC 0 0  003 S 5C0 0  003 S )CQ P 0  003S C -P$M p`@L< @ D0 V70Y2*`,K80K0D00 K0@40K P$<0S [3[0[T3[0 [D[D[DT [DpT@@0Y: -PM p`@L, 0 40 V>0 8 R8*,0S T< 尐0T D!< D!{D!8T uD!ȠdpT@@<4`0  P8 0 R8 : -L R$R0R m!U|$S$ -LPM, @T @10 Q 0!000!@1 000@10S < P< @1Qs 0!00C0!@1 000fS$$0 @10S < <0 @1Q 0!00C0!0 @1 000,0 @BA0A0H040 0P080 A?㳠0CⳐ0C`0pE/< ,? 04  8 0 0CⳠx 0CⲐ`d h0p<XS? 1L1SL1S0 111S ,$|$$$$ 0-L|0@0tPS l 0S 0@TT0 @L0L0 00尅44 x,00$ltn!`n!T$<"S$ ADS$ -LE/p`0PBA0A0H1>Q  000000PIS? 1L1SLS$$$ȁ -L0$@"1A  00 $n! -2$ 11LS  "|$ -L`0 X0 0RD0Q<  A? 0R0Q -L ,M4 H p#T >T$21!0L$ 01 A?!00< 1S1 0000 0L0 ,D0S>0S P<1 0C008A0$ 0L1 Ec000\ A?  C?0;<S AOC0S CP" <S AOC0  Q:$#\n!S$S$S$S$S$ln!C?0 C/008#8003RCA?< @LC8 04 D0 R@  OCT 0D@:*@ Pd UP *"P U*0S U6 2@ 80Q/<PH ' "<0D HPT "10Cs 0Cs t Pd0XHpT @ =<08p0PX P UPD0@p g@0PdcXPd H<XHQ  00 "000 1 0"00Cs 0Cs 0 R<008A PB@BP B@BT050C205 0R@00@0+w,L" Q  ".000 0 000 @02. 00 00 <0 P0RH 0b0 R020CS$n!m00000Q;0< S08S 8, <0 10 S1 1@T 0 0S  ,HQ @< 0 @0 H 7<  ,"00H 000 4P d0d 004T, 0RD0PU 80 @ BP ڔP"0 #S$Xn!#S$\n!S$ 00S$ -L`p, M€ Q , P10 SWYXT .V0R .W 0R0, 0,0 @bV%*00CS!:  0nR 0@f 0 d@4 @ nT $#S$S$ D0 0@ nR ,Q 00S$ -L`PpM P00S(010S#>S>Sh0h PPP  P000@nS0 U  00$##S$S$ -L`@pPM P00S-010S(>S .Q0Rp0p @@@d000 aS0  00T  00$##S$S$ -L`P00"1A 1 `R 0 R`#*10S  p0S Rt^Ẏ>. 0nS 0.,0R >S 10 V S00R<q 00R 0Q*0\ *0  0nR RV^Ẏ V V 000S @0.0 0nR  000$S$S$S$S$ 0-00LS# P0S 0CS0t00p"10@T T0.0 0l R ,, 0 0#0 0S$S$#$S$S$ -L0\b\RM00 , 0^40 ,  ,B,0R0b0 R^*2 \ *100b\**l @00`#0S :\* l@00`^ 1 \:|100b\0  0 S\00$!0\ 0 pWx < 0080 `<<^ W<0   l 0 @0P d\,0V! W  PlPX0@0` d\0S$S$S$S$S$S$p,8 W, : W  0l0@0P d\d00 ,0 0 SL00,0 D,0 S, W$0pWp4Aq4 S$S$S${ -L$M, 0C ,s00 p4 | , @ 0D 080 D<^<  WD0   h 0,@ @ @@P d\4< 0RW  PhP,@0@` d\@00@0 @  @ 40<40 W_8pW:W  0h,H@0@P d\>_P, I 040pcc4 0@p0  -LPp` U @ T  0=@ TP U -LQpM,  (\0AS^ܐ 02#`, < P0a@ 0@ 4 0<80 <Q U<0  d 0`@ `@4 0Z0#03Z03S 08 RU  @d@0`0`@֡0c0A? 0 ,@@ 0<0 0 0S0 Ť0@ \  j 0@ iP C?0@  0 j$##S$#S$S$S$S$Xn!|n!xn!n!3 0 0aRa0\ 0hS 0^X 0h0j "SSX   0AR0 00 0hS @0A.0 a0b0A? 0 ,@@ 0<00 0S  !0 0S0 ż1@ \  j 0@ iPD C?0@   0 h jP5 j0 0h0j~0 Pj @ nR  02"Aq AqC?@0Z!00CS@\(@ 0 h@P jP P0|n!xn!n! 0hPj0#U' T   0jiP$0 j  >00A? 0 ,@@ 0<0"00jSaC?0@  0 p2 0 b0dR\0P 0hS 0 RS 0h0j "SN T   0jiPR00j 0 0 0@00lP.0 a00A? 0 ,@@ 0<00 0S  @!00jS0@,1X@  0D C?0@ 0 h jP5  0+ I0j 0h0jxl 0 @ nR  02"Aq Aq|n!n! -LP`pM, € A P00S,XZ) .U0RV 0Q W 0R.Y 0R, 40 00b 00$# -LPp`M U*0 S @eV! V4*0 S0 @fV @ 0  d 0 - d 0  @ 0 P0  0@nQ 0nS 0 -LPp0!S21A 1 ء;0`S V1! 0œ"1 Ր R 114 0R8 0R04000C?0 @1R R 0 $0b0  00C!S00Y0  1S  0 \ 01 R p 0s|@00 40 !8 0C S$$\n!S$S$S$S$S$Xn!#S$xn!|n!n!## -L`@QM0"1Qpoe밭ZcT\ 0S#Q_  00 QA00A00QAQ00AqD Aq00>0嶒0 0 20 pcX l S @ 0 0 g p@ P dR   l S @ 0嶒$ -@1LS R 00CS0@p001 -L@`QM pJ$ V 0S DP3 1PX30S H30 , ZA?0W 0,0 1SV @a000"A?pᲠ" P00R0S, " 0@2022 .00C000C00@P 0P@P,000ʶ<  ":R P7<2 0@202.000 <00000@^ڞ0@ ,00xN^ʞ0@ <  "0102, Ry  !0000'9I9P` C9@?9T050C205C?05<S AO090S (9P <S AO90  Q: $S$C?0 C/008#8008@ 8 0 10S*@0PU& 40 @8PP"0  00S$\n!S$S$ 1Pd01@T 0 0S  _Y 00CS0 I# -p,M0LL S񟗄ıxl$ T 0ASP 0 S S rP RRTՀT TT T T XP _  @P0TS 0  0 0`VL* Y2 @0`V:APQʊ0`V9* F2@ @0`V:.P0S0`V'*Z P 1200@PU 0j00`V:I7 0`V * 2뀀 @0`V:P T04P T`@P #0S BP 0S0TS B?B#00P ST  B;P EO`>V L0L8#21a$3$#A0 0 3PR,,U QX@\*  1 T  d3 P0X:LQ0X@E*  1@T @d2@P0X:5QX0*A/0@T 00000@00T 0d@T 2P0X:0XA*  q1T d2P0X:WL @Q211 n  =?0 0  003SHK 2P :HK0)0KF P3 0L0 0 0 0D) @L`T21Q=PLTY 21 0RR ,000A?0L 0 1 $$% -L@pP0 @21a =S00S  0^ 40 0t 40 0d 40Q0L 1D 0004 00@ $#T$$T$DT$n! -L@0 0PRtp0S `6Pc000 0 P:000b#S$S$S$S$ -L`pM℠,0 W:0W*@j@6Pv60 0R000h20 0R*00S& 00PcW*t0t 0 0bPP@x6N640@h0P$0 00P #S$S$S$S$S$ Y,0S -LB~ 0@, 2 S`0* 0 "2, L0* 0 "2, ƒ800Q,0(00QN~S$S$S$ -L"2Mp, "\21aX 0Sh21, P00RP< R:02004 R8 0R4"0S( 0Z@1%0T 10T1@ @bPb/0Zp!0T|t1@ 0L00 , U e,10S%a A,0 cR 10R00SQ P00SJ01, Q00R0S?lC?0 S 0\c \0< 0b<0QS$#$#Xn!#S$S$S$S$xn!n!|n!#0`QA?00PP 0S0 -(0LQ 00S"S$# -LQ Q U0 00Q l0l 000u)U U@00!,00S (]v 00!UT$S$<"`n! -L -L`@,pQ07P @ n! p-LP@L`L0U 0S00/Q\ `@ pn! 0-@P 1L0DP PEu( 000 .1 00 h -01L -L P@`  PE ^A?0@DQ 0(' 00!x0P!0@0S!\0pp!L0!0p8 00!,0峐$ ;0 ` x p H | ~ -L@PP 0"0R#pp0  A?0 BA>&m 00!0峀!0Ⳡ0S!0``0S 0p S0q!T0p!>`@ 004 90 ;C0 ` x X H -Lp`MP@. 0@  -LpM`0 00 -L@P`p1  -01L  -Lp`@0QS Ss S T't&d(r/HH1p`!?@1("p1`1't&d00(?TS2 `!? #d 01 4! 00J8 0XZ Q n!n! -L0@ 0@0 0cR1 0T,,0  \@#*,84:0t @00! 00 4! 00T!00!000 !0<!0<0 -L"x01 ,,0  \#),84:00 00! 00 4! 00$ p-L@Q`U 0S J 2T 1QQ0S0J  @T@{p$ 0-L P@0ES   U4 00,000uU !? ?C00\0!l?H1L LLLPE?A,@1@! Q$n!n!$\ -L@P J ᱵ -LM P 0S0S , /P @( / 0@ndT$n! LKH0@P$nn -LPM-!p0 00  q0 00  r0 01 0Q  QQŠƠƠp4` 0Ǡ<@D@WP  dL=$o!LnL <0,80@P@05 ,400 ,@800 ,T0 H 408"%,àlAD@(LpRjtMbhn -L@4\0X0T 4p000!@4q000!4r000 08 p-L0 `00@00t +00!0C0!X00P  HK 0 Q44!000pFn -Lp`,@K<M 2&nPPT,oPPN Pt@PF a`Pd0S d00` f6P3 51`051`00PP&!xx00!l0 0001 TT0 0S0 00C0PP ( 8@0S@ nL!T$Z6n 0-P8@LT SP 8XKD6x  8 0T n0nT$ -L -8@LT ? - 0LQ* q! - 0LCQ q! -L p-L@`DP&(1-1S+00CS%16160101#!Q000  0022" 00 4 8 ,0p(p! p-LP@`RM 0.ΠJT001 ?01? @cP""t0tU/Cb0? T0U0H0U@0U000 pppppgfffOPw+>;#30>+50UDDDD D0B- 1310 0ppXspds,<4,"4 0 p-L0@10P11 Sd2 ` 0`0!R4 00$4 00 40!R4 00$4 00P00P00P!R4R04000@!R400$4001 1! 0 @@!R400$4001S 3-Q4Q-`4`plo -AL0S S&\  0 0 0 !R4RX0400!R400$400 1!S4^3<|   !R4R040 0Q400$4000`Q 00@Q 400$4004q! -L -LP@pPM!1@T!1@`0`@1000CSjp@1S1000J@1S10V00@00=@V0001S16@0@Vx0x001S160=00ppsptrt0tt!C0X!00000 0000 000 f? 00 !00000 000 000!0000 000 00 00 000C0/0090C0000 00< 000C00C0`p00! p-L00!P0 @0`00000 0i?`0000000000000000f?000000000@0@0`0 B0@00!p -L$0$ 0Q000 0-L@PP U 1S Q1S 40Q0Q0E010q! -L -L` 8A8PLPLPA P T00SZ`Fv0 ph ! , * X^000`Fv`FvAL ph 00 1! X^0p00agg`Fv -Lp` @P  B  B  @h 0"0R#x x000000000 0PEu7! XP00PEu -L@\\M`, Ap4R0 P̀A@A@A@AZRfPS,`,00 . 00A00 Zx p0`0000Z b 0S  ,0 000A? 0Z -LM`0@R̠, A㱠pP00000C`00 00C`00RD00@P@,0 r$0  A0V0`A00 V -L`P @C/B  B  `P ^̠ ^ A/  p0VPA/p00 0# P*D0 0Pp:A? 0\0pb -Lp`P(A(M, ! p  B`P  ^  BP A/^  0p`U,0| AO,0 0 ^00!000 ^A? 0\0b -LpA@P`000C0000C00000C00@00B!X0000 X -0LS0#1000 -LP@A?p 0UZ HXF 0S* \0" 0L00L0\L0\0L| L0|0 \0"0~L0b0~L0b\L0>\0"L| L0~|0bT00SZP .!A?0$"`Fv P* \0 0L00L0\L0\0L|# L0|0 \0.0rL0n0rL0n\L02\0.L| L0r|0n`FvA?00# "0h hAP* \0 0L00L0\L0\0L|# L0|0 \0.0rL0n0rL0n\L02\0.L| L0r|0nhh`Fv p-LAP P!"H @0"0R#QU Q\p 0Ls @V\ 0Csp p-LA `PLu|00R@AB  0<,$ @ 0#200#00PE00u00#0pr! -LCx@0M, A/ 0^3 !" Œ0,p$ A?`0, P@u, 0 .! L 0#2 0 0#00PE00u 0 0#0 `pHxr! -LA?02#L|  L0|00  -0LS00000 -LP@A?p 0UZ H XF 0S* \0" 0L00L0\L0\0L| L0|0 \0"0~L0b0~L0b\L0>\0"L| L0~|0bT00SZP .!A?0$" `Fv P* \0 0L00L0\L0\0L|# L0|0 \0.0rL0n0rL0n\L02\0.L| L0r|0n`FvA?00# "1h !hA P* \0 0L00L0\L0\0L|# L0|0 \0.0rL0n0rL0n\L02\0.L| L0r|0nhh`Fv p-LAP P!"H A0"0R#QU Q\p 0Ls @V\ 0Csp -L @ pR̠ Œ Č`Nv00RPRT  ,0>. 0H #200 00#00`F000v 00#0r! -LC@>xAM,  00^" "$(^3 Œ0 Č1! Ȍ0 "q& A?`0, P@u, 0 .! 0P #200 0 0#00PE000u 0 0#0 `pHxr! -LA?02#L|! L0|00 -0LS0000 -L`pA?@ 0^T Kp30 SF 0S* \0" 0L00L0\L0\0L| L0|0 \0"0~L0b0~L0b\L0>\0"L| L0~|0bD"0SC(20W00STP &!A?0'" PEu P* X0 0H00L0\L0\0L|# L0|0 X0.0rH0n0rL0n\L02\0.L| L0r|0n  PEuA?0  0# "0i iCP * \0 0L00L0\L0\0L|% L0|0 \0.0rL0n0rL0n\L02\0.L| L0r|0niiPEu -L@A p .! P `! 0"0R#00V@P V  @0PESP@L\ V  P0@DS -LAp00 0S 10 0#$1000@> 00Q" $(Q310P"0C SX^_______d____d_A?AqF A0!#21q00#0A?Aq6 0 #2100#00A01q00#0A?0`#2100#000100#00#21H 00#00S00100# 0@Aqs! -L`PA1M, . 0\" $(\3ptx1 x0"(0C S񟗔`bbbLabbbabbbaPEu A?0, @@t, 0 ,! @D0 #21t 00# 0PEugPEud A?0, @@t, 0 ,! 0T #21 00#00@D01t 00#0 PEu@s!PEu: ,0A/, 0  @B0t! 0#21 00#0001 00#00#21` 00#00S001 00# 0 @Dt0PE0us! -LA?02"0@0p!!& 000C Scccccccccccc|c 0L 0# 00< 0#00, 0#00 0#0@p -L@H0M0A? 0P,0  0"0R#\0S 0 `PBR Z   `0PES0,0aS PC0 0#$ W   @0PES -0LS00000 -L`pA?@ 0^T K30ZF 0S* \0" 0L00L0\L0\0L| L0|0 \0"0~L0b0~L0b\L0>\0"L| L0~|0bX"0S0C42 000W00STP &!A?0'" PEu P* X0 0H00L0\L0\0L|# L0|0 X0.0rH0n0rL0n\L02\0.L| L0r|0n  PEuA?0  0# "0j jCP * \0 0L00L0\L0\0L|% L0|0 \0.0rL0n0rL0n\L02\0.L| L0r|0njjPEu -@AL !Pp"P`0 0"0R# %1 W@P NQ?#Ϡ 0CQ@0PESP@N^  LQ?#0CQP0@DS -LPpA/W0  Ȍ0W" 1 @20H,0C Svk4m4m4mk4m4m4m4l4m4m4m4lA?00 `Av0#(_ q 31 00#0 1 00X! 00#00S  00 00#001 00# 0 `Fv1A/0 0`B0v぀4  31 00#0 1 00 00#0 00 00#001 00# 0 31 00#0 1 00T 00#00S  00 00#001 00#0 `Fvxs! -LP1M, @. 0T"  A/T3 00 !,8! p  B⃠ R񟗗nHpHpHpnHpHpHpoHpHpHpoHx A? 0, `@v, 0 @$$ !3100#0!1 00l 00#00S  0000#00100# 0 `Fv0H0xムSxs!HxM ,1A/, 0 @`B0v@4  "3100#0"1 0000#0 00 00#0100# 0!3100#0!1 00l 00#00S  0000#00100#0 `Fv0H0xムxs! -LA?0@ 0 "L| . 000C S$$q\0"L| L0~|0bP"0SàS420 PX00S ^P '!A?0("  `Fv P* U0 0E00L0\L0\0L|# L0|0 U0.0rE0n0rL0n\L02\0.L| L0r|0n  `FvA?0  0# " 0j jCP * \0 0L00L0\L0\0L|% L0|0 \0.0rL0n0rL0n\L02\0.L| L0r|0njj`Fv -@AL D!PpP"0`0 1"0R# %1 0W 8!d4!X@NP?#Ϡ 0CP`P 0@DS A8!d4!XN^DP?#0CP`P 0LS -pAM@L@0, ,!P000 0#)2000傐A?㳠 0 00JQ" Q30!Qz`" 3S00 #.30S00@#20S00#.20S000# $$,(00 0Sc10S00 #.10S00@#00S00#0S000# ($$4,8  00 SA3S00 #.30S00@#20S00#.20S000# ($$4,8 00S10S00 #.10S00@#00S00#0S000# ($$4,8$( ,0J,zm -Lp0CsM,  AϠ00 >, 0  0^80 8@l0,,0 ^30Q`!4 ,08 ,0 $0 0SA? 0>)A?00傐A?㳠4Jz 3S00 #,30S00@#20S00#,20S000# $$.(00 0Sc10S00 #,10S00@#00S00#0 S000#($$4.8  00 SA3S00 #,30S00@#20S00#,20S000#($$4.8 00S10S00 #,10S00@#00S00#0 S000#($$4.8$( ,0J8@zp$00 4@ B0 0r0@4@ F -LA?@ 00 @,"p0 : 000C S0pL($00$0(00(0,00,0000000 00 0 00 0000000000000000 @p -Lt1M0PA? 0P,0  <1"0R# U#0pS 0 P,8 4 0  AQ?#o0C^0C^000P0 BS0,a^ 0 0#!|8 d4 XN?#/0C\0C\p`P0NS -0LS01000 -L`pA?@ 0^T K30ZF 0S* \0" 0L00L0\L0\0L| L0|0 \0"0~L0b0~L0b\L0>\0"L| L0~|0bX"0S0C42 111W00STP &!A?0'" PEu P* X0 0H00L0\L0\0L|# L0|0 X0.0rH0n0rL0n\L02\0.L| L0r|0n  PEuA?0  0# "0j jCP * \0 0L00L0\L0\0L|% L0|0 \0.0rL0n0rL0n\L02\0.L| L0r|0njjPEu -@AL !Pp"Pa0 0"0R# %1  WP NP?#O0CP0PESP@N^  LP?#0CPP0@DS -@AL20 Sal20 0#'T2000pA? 0 00@Q" Q30!p "} Q3S00 0#0.30S00 0#020S00 0#0.20S00 0#00SW10S00 0#0.10S00 0#000S00 0#00S00 0#00 S93S00 0#0.30S00 0#020S00 0#0.20S00 0#00S10S00 0#0.10S00 0#000S00 0#00S00 0#0`@p -LCx@A?M,  0,>P0U2.0 0 U3 0 ! ,0T ,0 @0 0PSA? 05'A?00pA?P }b3S000#0,30S000#020S000#0,20S000#00SW10S000#0,10S000#000S000#00 S000#00 S93S000#0,30S000#020S000#0,20S000#00S10S000#0,10S000#000S000#00 S000#0 PEu0H0x` -LA?0@ 0 "L|!F 100C S< <<<܎<<<<<<|000004004080080<00<0 00 0$00$0(00(0,00,0000000000000000000000 00 0 L| -LPd1P0A? 0  81"0R# U!0S 0 aPBR ?#0CP0CP`0PES00jS PC0 0#!?#/0C^0C^0PES -0LS01000 -LP ` ^VO0XLA?0 @  R *\0"0L00L0\L0\0L| L0|0 \0.0qL0n0qL0n\L01\0.L| L0q|0n\TA?0  @D##t R*X0"0H00L0\L0\0L|# L0|0X0.0qH0n0qL0n\L01\0.L| L0q|0n@D0t A?00@D B"0C#t E R*\0"0L00L0\L0\0L|# L0|0 \0.0qL0n0qL0n\L01\0.L| L0q|0n@D0tc c -LP@Pp "=+0S0e"`A?02 T=W;V R B00 B00R BR00 BrS  Br00R  B` B`R BR00 Br7  Br00A?0 Br+ V WG00L00\L\00L| L|00G| L|00 B0r -LPA`L^v00$0';+@# V00R00S\000P`F0v@ -LAM`C0- R 1!v0 p< ,0 ; ₕ#' PA?p00 @@t,! T00Z00S ,0S0 00Y @D 0tP`Fv -LA? 00#L|  0L000|  0-LP "=+0S0E"@A?0PSD 100 aS0T0 \L00L00\L\00L| L|000 \ L@L@\L\00L| L|000 -L 00  -L`p@ ^W X01!<  @P *\p 0@ 0\00@\b 0t\0n\00SW) 01!PD<#uM @P *X 0@ 0\00@X 0t\0nPE0u0PD  B0"0C#u @P *\ 0@ 0\00@\ 0t\0nPE0u0cc p-LPS"`@0 \   0 QpC|  T 0 RL0|0p -L@! @8#80=S8#3#8 S S 1;0 8#000 0-L@P!0 @ L|* L0|00= S; S S 1;0 98#8L| L0|0000 -L0<, (("82:"*, -LQQ @=?0 0  003S  @(T  -Lp`P@PQQQ =?0 0  003S \ P -L;00 $0 KCOS p-LP `Pp 0 <830t T0P0L0; 0 000 '@T4@ PP40 04p pwA<"t!KCOS -L -Lp,Ml`P_}PP=?0(0 000V`5`LL@K 0( ,@ ( 0p(0 $0 04,KP>=?0(0 000V`5 `$x$0L0@ ,Q 0!(00(0!  80 P0 00!00 u!Pt! p-L`PP00p 0 I?0S MOW00up0S Ppx -00L @P ><-? 3I?<1XM80L1.<0U? @P004000$ -L -@0LS 0S 4@00  B 0S  008x -L`0KPpM=?00!@|0P, ( 00 0 K@T  0PK04$0@S  -LP4pK`@M 0p8P 0S*0S(0S 000(0S 4K*0S  0p>(0S ~ -L S$M^ 0   00K 0 00 (K( $    0 @00, M -L S@$M^ 0   40K$0 0, (   @  0  M2S00 ,K 4@ 0 P p-L @PM`\0 0 @ 0S M  0@p -LM( $   0  0  @PM (K 0B2S00 (K 0-L \@PM*0^:0  00 0-L \@PM*0^:0  00 -LMπ    -00 M?0L -00 M?0L< -L@P Mdx -LpR  pP  00Mo@TW ᤂQ00000S  000 00CS00S P 0SY$ P 00000CS00S p#1 00000p00CS00S P 0000000CS00S K|@0000S  00008 84Q  e 00CS000S  8"F 0-LP@P P0Q갭ĭ0 RP  Q M0 -L\` M`; V8\ V  0S? 00p Q0SD@Kp O0S`P s@PDPb0PP`$xd$xx@ -L0KM@P@P~ -Lp`P$0KM@P/ (0K@P&$(0@P$@P(P@P0@P@T ᓨᑨ(E(B$@ p-LPK`M@P PK P 0  ]p 0-LPKM@P ,00U1$ Gu!0 -LpKM`P/ 00 @P( 22000 0P W PK K0Pf0೤0  0P P   p-LPK`Mo@P PK tP 00  p -L`KpMP@P PK K0P  0i Ǭ -L`KpM1@P PK K0P  0J 娬 -LP@KpM`P# X0 K  @ p 0 0 0 0  @K P @ 张 0K0  @0PP \ v -LM -LpPK`M@P% 0,0 (0 000 0KP PK40 0` @KAK 0ㄠz R!  )l` 00  @0 0t @TA Z 1 P  l00 Pt0 0a001 SA h0KX !q -00LM 0S c 0-LP@U Mj=?0! 0@  003S,K @T ,KzT S,(UM꘻Ļлܻ,@H\p|$ :$ 7$ 472$ L/$ ,$ )$  0%$  0 !$ K PP$  0A$ K PP$ K > $ K ^$ $   u!0 -LQ0 jh 0 S xd$ -LQ0 1d$ -LP`@p T00Q Z@R GTdPP00PPy p-LR`M+P=?0 0  003S @K @PU  10P0S 80P !0('<0!?A6c10Ghp -L(M`L P LVP@ P pTp00000S 0000 00CS00S P0ASP꼿XLT -? 1:0<0Q & p$&p"h2ppX2 0 T@! Q;0 2 0 T@!Q<@0@10S{pppT -? 1:0<0QI CV`=?0 0  003S@@K n`VP@0S0 1P1111Ѵ000pL0*pptAT003  -? 1:0<0QW p V`p 0  003S 8K %p 8"4u!8u!GV 8KW xH@HpT 0S! 0!00C0!80[S 0b 8KRP] <0 0 0!00C0!SRQ#PVM=?0 0  003SH@K `^V83000P 0300CS00S  ! 0!00b0! 0!00C0!Sd| 00CS00S ?dy[t@0000S 000808 4R  q00CS000S 8" -L@`M qPP0BS񟗿0@ $```````H00 200 00 00 @00 &00 00 ?00 0 !3!Q  0!3!0 w00 t00 q30 n00 00 120 d00 a00 ^00 p 0?2c0 #00 p0C0 0 It0?2c0 #1?2c11!B2b!!" 730 400 1*00 . U P#=?0 0  003S;.pK K0Pj30S/:=?0 0  003S 0 S000 [=?0K  0UP!  003S P QP  p-LL0`@dzPUT ,b04 00408000p$ -@5LS P  ! 0!00b0! 0!00C0!S{030S 0zy$ -L @ 0!l00bl0!0S 0!(00C(0!S -L  0!X00bX0! -LR@l 0RP 0!(00(0!00 @00!l00l0! -LR@X @0RP 00 @00!X00X0!x 0-LPp0@ U00 S 0!000!yP 0!00e0!0Du! 0-L@Paz 0!00e0!0 -L`@@K M]?P0#VX0 00P= p 7P0x0hPS 0!x00Cx0! S?< Z 1*#J0X0pⴐ hP, PV! =?00SV` 0!(00(0!L0 @00!l00l0!0vPP0P -LM00 m -Lp<@K M]?P8P ,@K4`00T 00CS00S , 00000S0(8" 8" 0-LP000@00TQ0 -L 000P P00X 00CS00S P 0!(00C(0!S 8"(8" -` 0L00000!(00(0!00CS00S c 8" -L 0-L@P \P0! R 0 0C00P 000!P x0S 0!x00Cx0!Sl0SX0S0S 0!(00C(0!S000 0|500 E?%500x<" -L -L^ -L^ -L^ -L^ -L^ -L -L^ -L^ -L^ -L^ -L^ -LQ Q ? 0lR |0 S 1 00 <0 R  -L^ -L^ -L -L@$M]?P `p@K0 8@ 4@ , (@ $@ ` `<0 @gal aA@ # #/8K -? ` 3 0V 0P" 0 3? -DLP 0 R   -@DLP 0 R  P 0S   -@DLP 0 R  P 0S   -@l 0LSDP 0 R  0l ?RP 0S  q -LP w 0-LP\00 \0 p00p0 000 >|%0 0 \@0 0 00C!0Ņ  "? 0D0PD0L0030C 33DDDDD@1#33( ŅE0x@u!   aRP< M 0P * 0!0!000! 0P:00S !10pPq00( a000 ( $ 00 0 $ 0 000  0- 0CLPcU 90 @P  0P0x0S 0!x00Cx0!S90 p-L`PdD@Pp 0 0 0 dh0S h0d 0S 0d <  d0P00p- p-L@h `R0 0CSV 0dpR0 C 0  C 0x0PS 0!x00Cx0!SU V 0dp -L@M00P,0 d0H`C,0pZ. 01Y!q0 S 0 S R Wp 0P8U 0 0} 00C00 f0! `,0ZV*d dPh0 e0bh0d h0aU dPh 0000S q0S 0 S R 0e0ch0dP -L`0 0PbUq0S 0SQ U 0P d A 0P000 Sh P0pW*11S_Pc0pW:UX p@T@d0S@Pc2x0S  spP @d Uh00cUcP d0 0ed0 P$W x0S 0!x00Cx0!SU0  x0S 0!x00Cx0!S0@TW@0p P0pX(*A1S 0|001Pc 00U  000 10eP10pW:00h 0 j0h  -L`PpMd0d B0eVi@fT T@  'PU\`00Y0*0XHH010@fT,0 T@ !0  0 c2l217clL 1hPU `00,Y:0P p0Xpxyd0 @fT T@h 0P PU `p WU D{P" -L`PMdpA , @fT T@ #PU `,@ 00YJ* 040 0W0110@fT00 14! T@8 040 < 8c2l217clL < 0g, $, 44<01"PUC ,`, 4 0 4 00pY:0P( 0Wڤd0 @fTT@ g 0|,0 $, 44<01"PU ,`, pZU 00D{,P"I -Lp`M, 4 d0CPgUUP 0,`V ,p4P , 00 0 RP* 0<0 0X@0110PgU80 4< 0,1UP@0 @ <0@ `l`@lL  h4  $, 44<01"`VM p,040,0 4 80< 0 < 00 ^:0P- @0Xڸ1d0 PgUUPh0, n4  $, 44<01"`V p,040,0 4 @ TV 00D{xP"  p-L@Ms0`S 0Pcd $PBd 0BU00 Md0U  0e's0S 88"0l #8 0p 0-L@P40PPP PPPP,P0PnrPsPtPWPPPPP0 -L`p@P SPP*@ P=?0  0A  003S @YT 9T P  pU*0PJ R: -LPp `R R V@1@!=?0 0  003S Q p`d 0d PV -LPp`R0S V@1@!p`d  0d PV -LpP `R&Q Q@1@!=?0 0  003S ?T X `dp0 0 d0 PV  -LP`p0 V%:`cP0V*? 0f`S@1@! 0  003S  T XpdPW  -LM0 4 , 0R8 :4  c004 000 0R*0 4`0a S 0!@ Z<0 4 H pjW$P=?0 0  003S PT <Up<00Y0 aj8  ` _P=?0 0  003S PU UKj8 C` g<08 @gYT000T @j P=?0 0  003S lP U$T =?0 0  003S,0K080 ]8  0,0 ,0S  0 c00 Ym80 0, 0,0  -LPH@Kp Mm?`D` 8K Dc0 !3!@aT&\ \0R'0)?0j@ SS 0 S 0 S0S =?0D@@K0< s@@@-? D00<@ @ -LP`p0M !3!aQ9P   0!\ \0S@@T 0!x00x0!!\0!\ R 0 0C0\ !@T  0 S  K_P  -x0LS 0!x00Cx0!S -LM  K0  -LpMdAP, @gT T@ PaPU^p00Y4*0XT-`010@gT00 T@ !0, 0 c2l217clL 0hP+PU p000Y:0P `0Xld0 @gT T@h, 0P PU p` VU {P" -Lp`(Md@ < @jT4T@, 0 P ,0KD0 =?0 @ 0  003S 0  003S P@ TD 00,0 S`Vp<@ 00n0X8 P 010@jTH0 YT@0 00 0 0 c2`217c`0@610 0Ph00KL0 >=?0 0  003S0  003S P{-P"TL 0000SX< 0 $, 44<00"`V0 < p < 0H808 P:0P3 P0Xd0 @jT#T@ h 040 40K00)P< 40 $,#44<400" `V0U <0p0<0 P UV {O -LPM0@Sd0`pfP0S 0S*l0 i" ! 0dPl  0 KP  088"0#8 0g   0-@DLRQ 3PS 0R P0'\ QP\0R AP?0SS0 RPQ0 0l ?RP_10 -LP 0@ 0C#aVVT j@P  0@0 10p RPUPPP0U00 0- PLU 0 00@SJ0@TZj0 -Lp@0P S@a` Qi0 0c cQc^I0S S Z `PU=QR? 0|0P 160 <0 R'  01R 41R 81R 100 <0 R  @1R D1R H1R 1@00 <0 R ``V0 000 B bR@@T P @Tj @U 0S m -L` @ MpW  R0001R05@10305 ]?P 0  003S, ( 0@ 0K \ D 0  003S \ 00 @ 0 0 d0  -L p` M0 , 0  R40  0B#100 00 @Y 000 #PpP =?0(C0 <00U540!0!000!4 @z00XtpPX1 @WXpWRpW LpW @0 0 d0 X0 R00Y0S 000, 0-L@P  %iPP 0S J0!0!000!PZ+(0 -L q$00&q(00&0R:0R: -L P @ T`HM∀d0pC1 R񟗊 04 0h`TL|t0 e0 c 0 U Q $ 0 0Š0à<Š0<àl0@0\0\*0\ 0  \ \*\  0@0@Q0S0Q qxP 0p K0Pp0,$,!$#̂xQ0S hQ qYPl ^j K0}Pd&[VQ0#03Q0SVQ q>PQ Lk K0bPIk[DBP@000P7*00Q0.P, h0K( h0KQ$ P" "  h0K h0KQ P P P '"48<#Ƞr0<@ TV -L.q@^(A! 0 S0 S0S :000S000S0S0SSaS`S@^10S0S -p0LS0A  S .PP  =?0 0  003S` @T :T  0000@P0   S  BR 0S PU  ! 0!00b0! 0!00C0!S3g 8" -L0 02Q00<`00r`$<"$ -LP0` pU/0 3 1@\ @\ Q00D0S H 0!00C0!H0 f<"00C0\P 0U@$D$H$h$ -L@$0$ 0L$@$ p-LP$@bgp0@D0pd$ 0-L@PHH1“0  @PEU`l.ln n `,`l,.ln n `,`l.ln n `,8U U00`l.ln n `,`l,.ln n `,`l.ln n ` 0,0@ 0y7d$@$ -L8 0R P: -L`!M40 000Pp0S p~00@T- 0S'0 S$Pp0@ 0RDP H 0!000!4 00CS0c0S` r^ 8"`$D$x!(8"@TT"RpH1 0R01 e@P 00@崀0D0000 0K4,0K T 0D 0R@0 H 0!00C0!,0D00H,0S 0!000!4 00CS00S ,P$H$x!(8" 0-L@0 P^!0 3 0\ D0 S @0S 0D0H 0!00C0!\ 0^ 0!00C0!S0@$D$x! -L (@(P锓$L 0-L0 KM(0 0C$0 0 0K00P!^ !AhKl@000(K 00CS00S $K! !ex! 8"0 -L| 0000 Sdd0 00 #3D<0  4 00CS00S e 8"Px!Hx! $(8" -L 0000 S 00C0#3 <00S Q 00x 00CS00S 80S< 00CS00S ) 8"Px!Hx! $(8"} -LP\ p`2 SS Bx `pWW`$ -LP`lp2S S B P 0$01 00000`V`$ 0-@0L@PT  P0 0@T0 -LP 0!000! -LP -00 LR <0S 0 R -LP 0!000! p-L` X !^ !ASTK 0S ! !PTT.P0@T 6S| Pp 0@Tp|!~ -L ! P 0!000! -L 80 !R 50  0 R -Lp`% MP 0dS%P P<@K  04P PcU p-LP` c@Ph00p d0S0cp -@5L  Z( #Lx! -L@P -? 180<0Q  1 -L@P0LQzx0S 0!x00Cx0!Sl~<~ p-L@5`p,0,Pp XP "1S `P \XQ 0!00C0!X!000`V 505|5  'pLx! 0-@5L1 P '5,+=?0  ,0  1S 5 08#85'XQ 0!00C0!X!0000Lx! -Ly'Lx! -80 L    BR 0S  8" -Lu'Lx! -L`p0P0$ R(0:0R#P  0$0$ 0r0  PU 0S S 0R  @PHx!t~ -L@ 0 db\00 d 0 a' 0c\ 00l00 S0088"0 l #800s0 p-@0L0PS 0@ P x0S 0!x00Cx0!S,)00S 0 P x0S 0!x00Cx0!Ss0S 0   7S @P pb000 R @,0 2P!00CS00S ITp5I 0S@ ,0 t10S "P 00 00CS00S "p00 00CS00S "P x0S 0!x00Cx0!Sjcp"P |d 00CS00S x0S 0!x00Cx0!SJcp 8"(8"Px!~~ -L@01xx 000 0\ 0 L00\ 0800\ 0 0001 ‚hx!dx!`x! -LP0`S Ap0!1 0Q00GQ 0SI 0!000!  00 PP!0S`,`X0X [PP 0! 0! 10 1!0  0 R0000 000!0S 0  0 0 000!x0S 0!x00Cx0!S$Tx! 8" -LP`Rp PPh0S  P x0S 0!x00Cx0!SsT@ 0!000! ` 0!00C0!H8" -`L(0pS 00!(@(p00!T Px0@S >T$$0S 00!P0000!U @8P,,0n0P~| p-@0LS$ p0S p00d"0000T"$0 0P U  R 0R\ R Y 0!x00x0! PU0\1S" a0S r0S P\ R 4 0!x00x0! Ppg$!&3<0PU! 0S R 0R\ R  0!x00x0! PU\ 0S  p px0S 0!x00Cx0!Ssp$Hx!px! $ -LP` 0pS 0@ ep 05 0& 0 0pP 5 5 0& R  !%0%   <"5%0%   <"55V  &f[()Lx! p-L`@JPP  X p 000Z00 0P00Il 00CS00S < 00CS00S U P 8"(8" 0-LPx0   @000QLP0S00, 00CS00S 0 8"(8" -L PM`, 00 VH 000@T4 < 000p000 p 0PWd{P RP00R8 00CS00S  8"Є(8"@Th 00CS00S 0`V0 0iPc00 ,UPU0(8" -Lp`@PT 0S 00@P 0S{00@P@T0S\ \00 TH0@ 0S0 00 200  2x!$|x!.$<" -x0LS 0!x00Cx0!S -x0LS 0!x00Cx0!S 0-PLQ ( 0RP 0, N@P $Q gH 00P<08 X@t0x  0!(00(0!0<"vv -0LS 50 t0x 00vv 0-L@P000p p000@2S 200PP0P 0 00CS000S 0 8"$|x!x!<"$ p-L@l0l0hP `P 0!00C0!S.OU 0h0 0!400C40!S 0!(00C(0!00S P 0!00C0!S0,@NV 0!00C0!S00p -LpWP WTT1   H1@TB 0S<W6 03x 1R/a` 0!00C0!Si 0!000!h 0Rx0 0S ` 0!00C0!SN 0!000!T0H t0x @T< 00CS00S  8"$vv(8" -x0LS 0!x00Cx0!SCc -L@  -LPp`10@   P" 4\0S0 0 0aS0 p0 0!400C40!S@PH 00CS00S `V000 8"<"(8" -@0L0S LP 0!400C40!S 0-LP0! @R @0 0C00P 000!T  0!00C0!Sx0S 0!x00Cx0!S0 -LP000p10@`T& X 0S`0000000 00CS00S  0!400C40!SP@TpW( 00CS00S  8"(8" -L`!000 10@pTH X 0Sp?00O4 00R+ \3?3:> 4YP@Bhx! -@LT 00kB -L$0!^ !AK|! -LP0! !Ѯ,0 R d0S |!$ -L@Pp` & R00R0S1@000Pc@Uڰ0SS -LP`p0@h0S Hu  d0Q 0d0$  ᲀpᦳ-@ -L@PpSML 0!x00x0! 8`0ΠL$W  @0M#$ -L@h0pS00g0S0 0`P1S h0S0  0CS 0P` Vڼ80g(R0  d0bSh0S0d0   d0bSh0S0d0   -L@P`MhpP00g0SP H  d0Q 0d0 # D 0 㴀0 `0V00  06 0<000 0,0 0#@0@00h0S` D`F᩻V᣻ 00S h0S0 C 00Qw|0h0S B 00Qht0h0d S$ 0  0CSZ $0K< @0R h0S0  0CSI @0 R h0S`0H`F QV40 I 0 00p\ h0S0  0CS  <0D0S P h0S0  0C_S \ 000g0d d0bS h0S0d0-  -L`@0MPp`0PU V0 @0   P`d -L`P@UPT00T 0 S BlQ q00S TF 00P@T@d$ -L`PpMF@P#  P0Px0S 0!x00Cx0!S  0LΠ"$ -L -LHMd d!^ !ASYK 0S!d \p0!d0\ @R @0 0C0pd0\ 0000!T P\ R:00S0!`Kh0 l  Q}/Q}A\x0 S `0`0 xL1S0 ` RA P0 0 `0 h R*<S' 0S0 `\X 11 0 0$l P N0d0P!Ph 0`d0S*|000\K4uX1 0Q.:0 bPڲ0 R 1 0R1(0C8000cPڰ0SS0S0 `0S \ Kl0  l00R ` R6 $0 $d0h Rhh 0aSd0*|!$$U(0h 00d R>0S d0S 0!p0 00@@!0x0S 0!x00Cx0!Sx0S 0!x00Cx0!S<0! !F00S d0S|!$ -LAQLL`p80``p }A x s -0 L12c``00 ~!<" - 0L0#0~! -0L 0!0  a000Sl0 Q :\0 b  !Q <( 000 !<"$~!$~!~!$ - 0L00@ 1# 0 Q  13Q 0R0  0 00CS00S ƣ 8"$(8" -T0L00 0 0000 00CS00S  8" p-L`@Q!^ !AS_K 0Sp\  0R 0 S00P0S 0 S00P0S `\<0 @ @! !:p(~!<~! -L@!^ !AK$Q =?0 (0! !. 0 0! !(~! -L` pQ!^ !ASK 0Sx@ T# 0SW 0Q0Q$00$0! !ҭ0 " 0Q0Q @ T! !Ѽ[$00$0! !Ѯ0Ph`!^ !AK($0P0C$0 ! !ѐ(~!<~! -LM~ -LMt -LPM@p`\   0P |  00000S0 -L\ 000P0 R@@00 00CS00S U 8"$(8" -T0L00D0  0  00CS00S 9 8"$ -LቁPM ,0 R  -<@PP Dx0S 0!x00Cx0!SSxPꠞ$؇,  `p 0V0 0!000!W 0!000!0 P+V 0!00C0!SW 0!00C0!Sf 0S + 0!00C0!/T@T 0S  0!00C0!U 0Sdp 0!00C0!, d0S 0 0CS.*D@P*꼇00 P 0!(00(0!h0 00!l00l0!x0S 0!x00Cx0!Sy@p -Lp8M,  00 ¸0`P VD H0S @@T+  0   .      .     \ .       $  (  ,劸00ЊP RP00R0`V0jPc00 ,UPU0 -L`pMPW 3W$ 0WNHQ @@T =?0 0  003S Ⴍ\1S ^L\)  Q 0S^P 1S* 0 -1? 0 0  003L S P\ ,0LQ4  0,GR05:,G0 BR* 0!4 040 4\o 2W080 SV9T (00z 0 000 `0Z0 000,T0  - P z\00,0S D P 00PD0Q 0k꼐H U + 0-LP@Q 080S P 0S 0@D0 -0M LP < 00 0 $0    0$K$0S'\  -0 0L0@P P  R'  -L0@P M,0 0  `npPr V v &q Pe , 00,0 ,0S+  R 0S QP,  @T ,0 0PӤ0 R^ P Z0%S+V ,00S+  0,KP !,0S 0 <@000, 00CS0 0S  8" 0,0 -L0pM<0 4 8 P Z~ z z *yP<  < PPPU 0SPU  R 0Sd Q: U 0 a 2RPP} 0lV80@T 0p`@0 RˤP pW<0U S  P ' 0!000!bUM < S lG80@T 0@` ` 0 RᘤP 0@0 @0S0Qy PU) 0l o80@T 0p`0 RrP pWY8p0P,  4 P0 Hz8  8 ,0KPU,: 0<0 0KP,  U @@000 00CS00S 8" 400 P00S @@0000z 00CS00S 8" -L0   h0S0  0C'S$ 0\ 00CS00S |, 00CS00S p 8"(8" -L@`phPP00e0#SGP P7$ d0Q$0d0(!$㢱 $00 p 000000,0 S<00 0000h0S0  0CS 0 0 0<0S P $00L0P00e0d d0bSh0S0d0  㪵-8 -Lp`PP M@pv@Ph; U 0S  0%uPZ   0U̠$dP d0S 0 0Bx0S 0!x00Cx0!S! -L`0MPp0 W,0 ,0Z@PT U 0 @0  "  $ B"P@PT0pWPd -L0M80 0 pP0 4 %HHP w '88TS T xS@T0@W$(H1(0pT0@6`Pc 0Y UwP$(0(0PU 8 8\0 48S<(@)T (T *T 0 -8P&080 @ 080((408 , ,KP 0,0(o80S   -L@p`hPP00e0#SEP H岼$ d0Q$0d0 !$ $00 ` 000000,0`S<000 00  0h0S  0C0S 0 0 00(\  0 P00e0d d0bSh0S0d0  '-L -LpP`P M@p@Ph"  0}Px0S 0!x00Cx0!S῰0 0 -L M0@0  &   R -LPM 0#SA`P< p@T* W$ 00S 0S #8 8SW x0 ,P 0@0 80 4 < 00@K@08 S @pTp 0!00C0!S0dL -L@d`pLL0LM 08P嘤fPP@0@0@BĀ!!Đ -LL0LpL0` 0c@)P``W:9=0<"<$4$Ȁ! -LP0d `0S  00 P0d 00P0d 0@80080<00<0x0S 0!x00Cx0!S -  0000L 0P0d 0P0 -L R 0 0C00 000\P0d 0bP0  -L 0SP 00C00000  d@P00dP0x0S 0!x00Cx0!S 0-LP@0! R 0 0C00@ 000!P x0S 0!x00Cx0!Sb0P00 -L$ `0R*  00 0d 0@80080<00<0x0S 0!x00Cx0!S2 -  0000L 0 -L R 0 0C00 000  -LQ , 0@ SQd0 `0S0`0! -L@Mh`0\0 00a0S 0Kd d0bS\0d0   -L M, 0₡Z$ p i`Pl` 0 cP2 00200 i c 0b\#?0  #50Z,  0 0TD$<" -LP`0p0CS000SL:$@PhF $q0`000 00P0 2 00 00!50Q0 01 001 10h0P 00000A00CS00S ƉD$<"! 8" -LPp0`@P 0S@ 0000000CS00S 9$`PV , 00SPpWZX$ 8"D$ -LP`P X0PPU @_p0 RP pWԠ$ 0-H0L@PT  P0 0@TP0Ԡ$ -< 0L 0S SS00Ԡ$ -L0@Md0 0 H L #xx@T !WP 0#48S&AoP! T0S !PX X T X  00S`0 ,3T X` Pd Xd`0P \ \P \PU 0S:W 0P SRPU\LP 0RS 0\"48SgH$"PP L0>@PL`V 00CS @@K ~+@T $ @P 0W \0 1R00C0X0T  0P 1#`!000\00P00CS00S L @T 0p`]0 RP pWe 0 PD *0-S0S 0000\000CS00S O 0">0 48S7$,< 8"0-S ,S .S 0 $ 0 ,  0H,dL0 @ DK(P  HD0,sd R X`0  -L@p`hPP00e0#SHP Tɷ$ d0Q$0d0,!$4 $00 ` 0000000,0<0`00 00 #8800h0S  0C0S 0 0 04\  0 P00e0d d0bSh0S0d0  ;-+ -LpP`P M@p@Ph"  0zPx0S 0!x00Cx0!Sӫ0 0 -L M0@0  *   O -LP0M 0L #S嚽`P Qp !pWo 0Ze 0 S PL [ LPU @ D 0TH0 L DH QB!((R 0R:("(R 0R3D0HS d^ 0 @0  *   P 00 000S 0 ,P  0@0 80  B4 < 0@K0@ 80R00D @ TD D00LQ  0!00C0!Sd- 0-LP\@0! R 0 0C00@ 000!P x0S 0!x00Cx0!S0S=0X0S h\6l0S T]03$0S <^)!, 0!00C0!0`ԑ$X$ -p0L00 M☀0S+ @@K ㇓m?`0PK<` d@c000S @ 00CS00S 6%000 8"t!d!(8"00X p-L@P00!a` R 30SR3`Qt P0 10A 0!(00(0!`@ 00CS00S  㹪pؠ$(8"d! -L@0 0! 0S S00 0!(00C(0!< 00CS00S Dž ㌪ؠ$(8"d! p-L@ 2` 0C8S]pV\p00PP ! ᬨ0P 03T 000< 0!000! 0`p p|!0X$ 0-LPM@To 3$0S  3$p#0$0 0!(00C(0! 000000C5D000CS00S M0 0pP0! R 0 0C00P 000!P x0S 0!x00Cx0!S 8"3 R 0S D0D0 K0 0!(00C(0!Sx\$0 0-LP=?0|@0 0!R 30S0T@@D 00CS00S  㧩 Rd 00CS00S Є< 㕩bp 0#00ؠ$(8"d! 0-L@0PS 00S 0 01 -? 1 0<0 Q \0  R 0S000QP#000\P#000X$ 0-LP0@S33 0S00S 0 01 -? 1 0<0\ ^0 30SIQ#00#0 00X$ -LS  3003 0300300 -L@Pi03 -LH@K`Pdß(ML d  P ;=?0UD0 8K 3P P 3L 0S 0!(00(0!@P@T 0S,0S 0S 0S P00 03X @0R0_ X 30S 0!(00C(0!Sx0S 0!x00Cx0!S ~]?P008pK៬X @0R30 0S?00ᯬ 0!(00C(0!S0Sw x0S 0!x00Cx0!SͧxA0S 0 @00!X00X0!\ 0! 00 ``!  0!(00C(0!Sᣢ ؠ$xx0S 0!x00Cx0!Sሧn -L` M00 3p4 ,  0!000!2QU Y~ #,0Sy 00 u Z p 0!(00(0!Vx0S ᴧ`` 0!x00x0!VF0S 0S 1@@ @3*X @0R%0@"0S 1 P00!X00X0!\ 0! 00 ``!d@T l0`40 0!(00C(0!SPU{ 0!00C0!S ;V x0S 0!x00Cx0!Șx0S 0!x00Cx0!Sᾦ4QZht!ؠ$xd! -LP\\ p A`T U #0S 0 c@Tؠ$ -LpM P ^0S 0SZ,  1!01  ?1 0<0\  Ri3 , 30S`P]0Y` 0CXX`Fd@PR 30@03, 0H LD040=?01p[`P0h0S 娱 d0Q0d0d  ?P x0S 0!x00Cx0!SX$-tDZ 0!x00x0! 0, Πx0, @0z` -L`@ pMP^B,0Ku@P+ d X0 000 0 0Ϯ , R 00p@00L00 0040ᡮ3$0S @0X ?RjdP0 ,P  -@3,0LS dP0  p-LPU` S@P 02TPyp@ 0V53,`pF -LP0X$ -@LP x0S 0!x00Cx0!SO} -Lp >ʠ@Ph 3$`Vx0S 0!x00Cx0!S/P\ 0! 00 @@! 0 P@h0S ~ d0Q0d0 000000 P\ 0! 00 @@!d 3$Px 0!(00C(0!S؟-I -L$@p`bPPhC $㻍`0p 0 0!x00x0!0@ 0@P 30S 0!(00(0!@P@T1n3$`V ) 0!(00C(0!S቟$P0ؠ$ -L`pR$000ャPP* D1 @1@ P 30S 0!(00(0!@P@T i03 0!(00C(0!SF@@h0S 嫯$ d0Q$0d0d $0Y 000"00  ҋ @ @0ؠ$-hL 0-LP@~Ph0 3@D 00085100CS00S 0 8"ء$ -T 0L00D0000CS00S q ٕ 8"ء$ 0-L0M1PS 40@nj 0!(00(0! 0 0!0C4 0!(00C(0!Sᷞء$00 -L` pM, P0AT" 3 0#  X  l #$  (   ޗP 00P RP 0R@TX0 0jPc U PU, 00xؠ$ -L<\$ -LK\$ -L0 ĠS .S 10A 0S.S0 R^Z  8 #,  -0a0L  b 0b0`4# ` c&"cb" 0b0`8# ` c""cb 0b0`5# ` c'"y7Ȣ$$ -LXQM4 , 01 ʀ! Kx1pWql!000`10AT\ 4! R4! S(0JoKP  0Q81 0(000 00 0U 00$00l PR(l R  0R  , 00081   D倐04! 0RD 00CS00S +~px$ 8"$,(8"@TP 00CS00S ~pWZ410, hR 00b0(8" -LTM80 0, 0 4 @ 0<0 0,  @$( @P`p $ , ( 0,408 d4 <8< 0嚖@P@ Z4 a8 ,Y00Y 04!̢$  -L`1 0sUJ||1|!@0 `1PP? Q 0hS($0S1 0 cR 0  0S 0S\ R0 Q  RZ@P 000 S0S P PH000cS800pWZ0`0$`$܁!Ģ$<"؁!$$$ 0-L 0 !0@T'0000!P0000CS000S ,}P 0PS0Sw P FU@TZ0Ȣ$|$$ 8"$ -L1 PR``@P0@00psP T00S eV 0 0 0bQT@T ʘ 00CS00S |\ 0ST0000< 00CS00S | 8"<"Ё!$|$ԁ!(8" -L 0@0<"!$ -3圓M0L,0  b(0R0(0*l3l#0Q,00,0P3P#@C 0BCT4ß 0$ S 5 0@`Tڤ/3 00S00@c0 2/0 0S@!@1"0"0d00, 0cS%T"000դp"p2pWaX0 TP2`P@"000PB "\& Q 100aS1 0  cR 0 0S 0S\ R0 Q  R^`P 000 S0S` P /@DP!00CS00S {TpWZ0T800000P 0 00Q900SP0,00cSzH0H 0Q)P P六40040 <"d$̢$!4!x$!Ģ$l$$h$P!$ 8"(8"|@@ @@00S0$0 $0R*P!؁!!4! -L M, 00 S00H0 0D @0 8 < ,x3qt 4 X000@Tu   PP` 0R 0RY; 002 00@000 0!000!4"00CS00S M{X 0Spp" 0!00C0!0S0SP [0 @Q!0 b0 0S 1\ R @0Q8@ < @ D@TD 8 R p1D0Q 0< 00S0SKP 0S 0Sl:@Ph 00CS00S zit X 0S 匬 0!00C0!0S0SP QH0ASH @PD@p00`0C0`p 8"$<"(8"`^!$`!}P tXX 0SXX O 0!00C0!0S0SP hꔔaD0 004 00CS00S pz0꼢$(8" -@L5 0000S0@0CS00S Pz\ 000 0!00C0!S PP 00 00 00CS00S .z 8"!<" p-L`h@000\P0#$("("48<#80 00CS00S zp 8"p$ 0-LP@Q! 0SP t0001 8!#(00CS00S y"48<#800喫0 8" 0-LP@ 000T 0S  0!00C0!00! 0S S000S0SP 4 00CS00S y0 8"Xd$(8" -L0M`@ D H0 V 0!000!H 00 < 0,0 40 T 8 P @ YB R 820S \0SR620S\0S/ 2# R) R' 00 S# A 0Sh0S@  P 0Sd0S  P P L 0P0 0K8PKDLP  q0T !f10X AT 0D S 0R0T S 0R0S0 S0H SdPU0@ S0 S 0!000!X< PT 0S00 太 0!00C0!p!$ !g <0   PQ 0!000!<0DrP TX0hPlPpP嘐'  h R00<0Q 0!000!<P<0h000S7<0hP 0  T 0Sll!J 0!00C0!<Q 0S(,!9< 0!00C0!<0S%0SP XX<< KP<@T 0S  0!00C0!@T(P  RP L00SL0 0!00C0!S<",ipi j 0!00C0!Sٻ p-L@TP `V 0Shh ϩ 0!00C0! 0 0S 0 !='@pk p-,@0PLU 0!000!3 00S`0S! \0` 00aS0`00`0\0%\0%*|0\0 <0bS0 6`0 0\ `0 0!00C0!Shpp!!<"!! -L@,d R$  R eR qR0` \00c ` R`\p0` 0R:0c `00x0S 0!x00Cx0!S<"!! -LP0M !h,0 "48<4!  #H0 0R040 pt0K8 4 00Pa 0S[8 0RV0SS 0RO04 SK0SH(0EV030#CV0S V ,0T:00!D0T0b8#H 0T0꠸$$\! QD0,0\*P h R000| 0\(0ұ0(0,`0T 0 0 S 0bS PYZX<"!! -,0LSCQ( L00Q103(05,404 0 0 S 0bS !!<" -L@P 0S(( h 0!00C0!p -L\" 000 0!00C0!S PP 0 0 00 00CS000S {v 8"!<" -L@ 0޶,Q (0 0R S 0bS <" 0-LPM$@  0T T @@x0S 0!x00Cx0!Sᡚ̔0 -LP M0pS0(0 4 `0$@K0 P 00 Pd00S00S(0 ( P 0! 00C 0!Sꬸ$$ k( (K  -L7| S8#80|0| "88S!880|0 -L`@PpU" l R `0S $((0S (0d ,  0R d0 S =,00d0|00d0,0L0Sh00L0,0\ S, D0S0D d0 (0CRD %D05D0( SD 00@!! -LpM`PU 0!000!0 0Sy Sw  Qs 7SpQ 8<0Si  BӾ,   ,0K000K00FPXH0@PB <1   x00S00pp尀``00!|0<0 000!000!0pS00, 00^2C0 10t  000 0!00C0!S< &E, f 0!00C0!Sᬸh !r̢$ 0!00C0!Sᚸ -LPMᴐ0 0 Y 0!000!@K 8  <0P 匀 K0 `KY㴠00 娠  \ (0S z Sx 0Ss u XU Sl 0S_ 0] S[ `K3`K0 P `Kt3 0d P P 0SC 10 0 #0Q00 Q 0Ÿ00K0<0KWP-P 0S Q0X0pW 0!000!p P  \0 h0KK*P 30P0 P0S # 1 0Sh0S0l ԸP 7S W @P    0S000S000PP  娀吀P<000  0!000!000!0t x 넠0, 8 0!00C0!S ~\ 0!00C0!SpP P 0! 00C 0!Sꬸ$$̢$p! ! ;'#Rg00S   0KKP W`1 K  Ha@PF <1   x00S00PP!娀吀0|0<0 000!000!P0 0t 0[KS 0bd0 10t 00hd 00 0巼 0 04 00000 Zh W 000̢$ !rl -Lp@PM`< %Q10Q( 0S0S0SP0S000 0!000!0 00000,#l 80080Q0SP  QP  0M 꼢$<"̢$ 0 -LPKp8 M @T0< 0 0 0 0  @0K 00K@K`KPP `KP P P# @0ࠠ S S  PP 0S 0 S  r  U 0!00C0!SỳPP0 ΨPP 0S  0!00C0!Sᥳ 4S qTQ ˻T T\ 0SK [  Q 㻻T X0S"T0SX0 P1T0 X0 U 0!00C0!Sp Q 0!000!0< 88` 0 0`K0 P 0`K0 Pd00S" 00R TQ sT  00U 0!00C0!S-dI$$00 0 S@ S+T0SX0T0 U 0!00C0!S 4R 0!000!<0`0 P 0! 00C 0!S00704<S`0S  l0S `0S1`K0  T0S0PT U 0!00C0!SŲ0XP 0!000!<0`0 $"̠T0  0S5 X0s00K Q00K Q 0S 5`1V 0!000!` 0[堀KS P( 0! 00C 0!S$S  1PQ 0[S 0! 00C 0!S00@P}    0S000S000 0 0 0000X00T000S<00P 0!000!X0h0d1T x0 0!0 0H1t0X00 T0R0 51x0$00$0 儐0 ! (0S P 0! 00C 0!SU 0!00C0!SQ 0!00C0!SNh !̢$  0-LP@0  !8!000,10Q8 0R- 0R)0S& 0R"0 0#000 0!000!0 00000 00CS00S Np0X <00<0Q@ 00CS00S :pl0 8"$<"̢$(8" 0-LP@ P0,0S 00 -LP@`pP,0S  0 -L@P Mh,`pP00g0SP ՟ d0Q0d0"@ 0崀 PSU0P0000000 00 000#((<00<0h0S  0C0S 00S 00h0S0  0CS 0\ h0S0  0CS <0|0S h0S0  0CS  |0Q h0S0  0CSy 0 0R h0S  0C0Sg 0 0R h0S0  0CSV 0(PL@ 00b@0 040 0D0 R 00c<0 -<"< d 0(0 ,0 00 8 0S 100 $0S 0,0 0 0$ 0b(0 h0S0  0C#S  D0Kq0S h0S0  0CS  0a00g0d d0bS h0S0d0<" 㖖 -L0 h`pM  㨠 0 b PPw 0 (00 0 0S0S00 0SX$ `Pa 07A0000 ` 00CS00S n,0V0 d0S`c@K8 {0`K⌠ 0K 0R0K`0 W`V"0,00  0800@ H `@ 0f`P Y` `0@ @0SP``x0S 0!x00Cx0!Sῒ 8"$ -L`8!M0pZ0,0 v, Zn!00000QpUY WSU 0!000!,P0 @ 000P'0 !,@,0!T 0SXX Ɵ 0!00C0!8 00CS040S1 m/$ 8"$<(8"0 !,@,0!T 0S|| 垟 0!00C0!PpUL 00CS00S m( 0Zpdܓ(8"$ -L -LQM 00 0ᚸ 0 $ -L 0S}P  0-L@P 0TR0000SJb00"!T 0  y0t$ -p 0L00 R 00 R 0 0<  000 0, 00CS00S Tm 8"!(8" -L ZF:qaPV@!1R01101 Q00@ QPW@!1R 0@1@101 0Q00Q1W0001 p-L@MxQ0000SGK\1\`K0 \  0R  0^ 010\ 0^\000AS 00 @000S00 S00 10000000110S00`\ 00C0L00CS00S l\ 0' 8"!!$(8"$000 0!00C0!S HH 0 0@ 00 00CS00S vl!<"p -L000Q# 0 0 0bS 00CS000S Vl R 0 0x  000 0 0!000!L 00CS00S 9lQ 2 8"$<"!(8" -L`M̑0000K0 帡币@KȠ  0V010@T 0V\ 0!000!Tq00CS00S kT aP` 1 PPX0`00$0000Ƞ @K 0V010@T 0VT%01@@01Px0d 000000CS00S k00 0R@ 8"!!(8"$$! 0!000!00CS00S k%0$ -L`p0 S0P0 @0 0c? 2c }QD@@TP l0l l0T @ 0c? 2c @}110 AD@C$!!!Q!!<"! -L h0 RZ -L`p M⠇P 0@0PP0 P0 xۃPll0l 0 ӃPWPg U PU00d!`!!$$Ĉ!ė8!ԗ8!0!` -L@!0\!1Z -L`Pp1$ 0R  @` P0 pኃ@UTPッ@ @P0 x@UPq@U@ 0 @ 0 \@P UPT@  P0 hI@UpC@W@g T @T00`p!@! $$D@$ؚ$ -LPp`@ pp_0 `@@WL @V@f T @T00P@$ -LL 000@0P, 00CS00S j 8"$(8" -LT 000H 0S00, 00CS00S i 8"$(8" -L@0p`$0V & PU 0S R 0<0R0$ #4 4 U@P W  㡎P ܑp`VW ґ$? p-@M$0X"0L R /@P0"0S\ $000d0h 0aSd0*z0P00 0!00C0!S00$ 0 1aPU $ዐd1`V* P L1P0S ,00 0P PUx0S 0!x00Cx0!SἍP`U00S ,00 0P PU  0㠩x0S 0!x00Cx0!Ssፍp?$$U`$$D$0  Xꬬp -LPMr0`SC q000x0S ύx0@S 0!x00Cx0!SZ@PT5 d0  Bd0QQbPP $0Q 0@S d0  Bd0QQbҐPP $0 0 A0 0 0 A0088"0#88 "48<"$$4!$ p-LP0@㹗,pP 㲗\ T`0 0b0 0!00a0!x0S 0!x00Cx0!S CVT0P0C0, 0!0P0C0!cpȟ8! 0-D1M0L0`S0 O(1PUK @E 0!$00$0!0((P 0!(00C(0!0 R@0@0@ 00 0 000C0 0!(00C(0!000K 0!(00C(0!Sk  40R0408!(!0! $0 0-@0LK,ӸP 0!(00C(0!0 R@0@0@ 00 0 000C0 0!(00C(0!000(04 0 (04 0 PU D军P   0㑥 0!00C0!S[ 0!(00C(0!S00! $ 0-LP@0 0,)P 0!(00(0! 0!(00(0!`0 R @@@0@0   404 0 0000<" !$(!0! p-L`PP @P 0!0P00! 0  001 0 00  D 0,0 0, 8@<$ (0pzP Up8!Ե\ -Lp`$ "48<# ∉ᨉሁ  d0 A0d 0Z Z00  s0Ss0Z0Z d Th00cTcgP d0 0dd0 P d0 hQ *hP0d00  PPPU D0SYd D0d 0@hT^Zd Th00cTc*P d0 0dd0 Pv s0S0s0@d @aT*h00cTcP d0 0dd0 P[ D00D0 00d 0s0S0s0$YPPP 0d 0b 0P!0!00a0!x0S 0!x00Cx0!S 5U D QYDP``0S<0D0000H  0d 0 0 0!000!X000 \0 0 x0S 0!x00Cx0!S8!(! -LP,M@P 0!(00C(0!0 R@0@0@ 040 0 000C0 0!(00C(0!000T D0S $00 0qWq0 S 00 S R  0P00S2 ` 㮆P 000 000`0V*11 `\:h  fh d h00bh0d0d 0bd00l0s0!s00!000! 00 $0c ld0R 0d0*P! W <0!00b0!P# h0d 0h0d0d 0d0s s0R0s0Rl l0  "l 0 00 0!00b0!PH0 ("("480S8X0a0 <  @j000@0 000Sw8,K0l0 Aj,wP X000@0 0@00000 X -? 1 0<0QS @PG 4@Kp4<1? B8c02c2cA 1a@/C#b!<4<!4"<0 0#"R. 8X0a0 0 020000W 0S0S8 0b 0 X -? 1 0<0Q gPY  E.MbX  8 0l0⤞ 0-P0LS 00 C@C S BDj @j0  @00C000Czk0S 0 @C@ 00C0@jk00S00C00 00C0@Yk0 -L@ `pPP =  FkT! W p=?0 0  003S  lp1kW _   i 00@0T@00  P EP ?P -L4`M0,$ , 0P @\00007 0, P@0Dpp@T0Sʌ rP0S D0 007$ 0000=P X0 0, P  @!0000 00$  -Lp4M0,P$P000 p r R0S0f  0S  0 00⑝W00` VM0 S,K00 0C40 1i,P0,0, 0P,@00CST 0S,, 導 0!00C0!,P$U 0Spp 囎 0!00C0!0S 40 Ch`0 V00 V000 -@$0h ad0L(0`Sd0*@和000r0, 0Cs0RjaU -LPpM,Z 0  ld0R 0d0* "  0d 0CS 0d *!@E00=>0!00 S S(0 R@  3SL000!00 00 00&@"48<#80 W 0S >0!,!$00 7Z$@ `V   0 &  0 00 A0 0 0 A0088"0#803L t00S00S ,0xP P L4$  P9 -L⤃@ R`  M ,P0000/ \ T30S  㢀P 4#0S00S  P$00Sx0S 0!x00Cx0!S0  uP "0S00S  PPֹX0, d0S00S ,`"070S00S P B6lp0R91S6 qPPx0S 0!x00Cx0!S w P 0!(00(0!41 00!l00l0!x0S 0!x00Cx0!SW& 000 0 `Gg 00CS00S [ 0d 0lS 0d *L z~+h0S 8$ 8"<$<$l0նP @尌x0S 0!x00Cx0!SSԢ #`  -鸂 R`  M0@00,0X0L, d0S00S h6,`X"0S\ P B6lp0R91S6 ᬁPPx0S 0!x00Cx0!S~ v P 0!(00(0!1 00!l00l0!x0S 0!x00Cx0!S~W& 000 0 `f 00CS00S XZ 0d 0lS 0d * }*h0S 8#P Xx0S 0!x00Cx0!S~ 8"<$<$DԢ0 0 0_`  -L`|M P, ؃R bH@T 0S 0 PH  @ 0SDXp 0Sp@K8 &g 0p 0 00 => "0C0 00K0h0K"&K06K\K 0K\KPH@0TH0 0S#x 0!00C0!0000Q 0!000!,X 0 0 0RX00d 0lS 0d *H" |=>0@4E00&"48<"#800 S S(0Q Z@   00#0RL 1 0 000 000X0$@ \ 0,10 00 00020@ U 0S >0!,!$00 - 0 00 A0 0 0 A0088"0#803| t00S@@T ,0xP, P ) 0,0E(t44$\0 XR`  000x0S 0!x00Cx0!SL}p 8"D$ p-P@,`r0r0t0t07L77V7 0S  0!00C0!,Q 0!000!,00@0@000000P0 0!00C0!S0Q 0!000!p(X -`M$PL0p, ,@@  p0SX0, <4<,4.<ݘx0S 0!x00Cx0!S|Y0@0X , 0 h4 S 0 SJ11Q Zd 0@4 0hS0Qq0S 00SQ@T d04S 0S 0CS: 0S x0S@T@p8p pd 0Ad 0c("(h0"48<#8008 0  0 A0 0 0 A0088"0#80`@0TE  pspd0h 0 d0$c&$P"48<#8080Sd080h&"("48<#88 00S0 000p00 A0 0 0 A0088"0#80,pT00W0S W0 R`  0x0`S 0!x00Cx0!S{@T0 08 #$(,&d8 0<0 Q8 4p@ Y p10 Wp100z@P p? 8"X$i@0&0  00h0S <0d 0S 0d " z0$00 0 P 0!(00(0!1 00!l00l0!$ -c0 0P00 g8$PQ&"("48<#80*< YR0 00(10$0  8R`  08 00 ("("48<#8 0  0A 0 0 0A ((" "( , pPYUx0S 0!x00Cx0!S{0 - 8"`$X$x0S 0!x00Cx0!Sz$0 R`  000 8"\$ -LM@s\ 1P   K]P0l0 $,#44<400"l0 -L8M<0 0@0 H0 T0 4 8 P0p0pX S1@T 40S4G4 4 Xb,00,000 4 0! 000!X0, 08<0$0(0 0^D  <<  0 ,0$ 4@H00D0 0 6T00@0 00P0 P P << Uw 0!000! ( 00 000'<;- U[ X#0@PM $(@0 0@@ 00 0:0 0!0l0:l0! 8@`d0A1H P0penŽl nN4 P(00(0000d0h 0 d0h H<hH < <Q 0 0P"Y0,0 <0<, 0l<0 R`  0,00 8"@$ -LM0 0, S@0p0ppS) ,04 0^ 6P0040 00`` V<uPU8H2PV38"0U00 ?0S* V P=?0 0  003S4K 4K4K (YVP=?0 0  003S0K ZP0KYU,P00S +@P <0,0 0!00C0!SԌف@bT MR ,0S,00 3#V V P=?0 0  003S@K KZP@KXU@PK X`=?0 0  003S  3Z` U0000S Xj808 40R  m00CS00S IQ Yu!0 S0!1 YPJ=?0 0  003S 333#1313#231 3s1 <101 ?F(1DH@01 T 0!000! X0,0 R0a1  lz 0!00C0!AT0000S i808 40@R  am00CS00S Hj000r(0$001  8"@!ģ(1#S0#1 ! 0000S i000808 4R  -m00CS00S [H eXP=?0 0  003SkK JV\ 1S0000S {i000808 4R  l00CS00S &H@=?0 0  003SpK V@pK{UT 0000S Ki000808 4R  l00CS0R0SO GMpK 0Ȫp0000S )i808 40@R  l00CS0s0Sp Gn1S0000S  i000808 4R  l00CS0F0SC GA@=?0 0  003S_K V@_K UT 0000S h000808 4R  Xl00CS00S G_K 0p0000S h808 40@R  7l00CS00S eG0000S h000808 4R  l00CS00S HG?0S[`q a 3!! fK 0CiK A Qw3 fK Ÿ0 K Dw!1 0b1 (W10001 + 0mKb 0000S Fh000808 4R  k00CS00S F1S V _0000S "h000808 4R  k00CS00S F A 0?R0S \  _?(K! VP=?0 0  003SiKA T\ Q010# 1 VP=?0 0  003SnK T\  -L>0QAfCfp0A00 0!000!Q 0R!0S00- 0Rڐ0S@1Q0 004 0R@0S 410Q0 00W 1X 0R0 00S 0X 00>0. SC6B60SW00 ?0S0 S;00 0S00h0 0!00f0!$$$ 8"@$t!h!$ -0L S. SC&B&T0!00b0!04:#:00S 0 0R00$$$ -L  0!X00bX0 !0 00 p-PLDcoRQ _L 0 SPAp3'S@@P 0S@A0@ 0S2- !Q t1S 0Q0S^?0SA@ 0 c?RAO SR 0 c?RA?@^?0 0@p 0-L@ 0U c?RU %QDP 0 R  j0S '0 ]0 -L@2c_Q  0CQh t1QY p 0 Sq00000S 4f00000CS00S E 0S2`0S ^?0S t1PJ00cS  1`R \ \0R`0 0 00`c`0000S -f000808 4R  i00CS00S D^?0`S t!1R`` 0 S 0S2` 0`c TT 8" -L@k0/Qc00111 R`P Z Rd000 0R,Q000a00CS00S }D 0 0DPHPH U"48<#82 0S v 0!00C0!0<0 00000100CS00S FDa ! 8"49 -LcO∡qJH"0000100CS00S $D !!0S `@PU 0000C0$0 1h0PU` X0S uPZP (@Ta00000S HHu 0!(00(0!000000C5D0p00CS00S C 0!000! 00CS00S C 0!(00C(0!S$c? < B PZ?0S $Zu 8" $kv`!  -L@8K M}P 0?p4p S2h 3S 0 !3!`] 0S2W R S 0`S`V rJ8KD kl3 03P0 000S d808 40`R  h0`0CS00S @Cf00000S Gd00000CS00S *C00D Ul 0S2# B# 8" -L PH@K$ML  `AP= ?0D0 Q8K$2##21@`D lxP-? 003Sj'0g\g 0pSpWeN 0RXL XP303dA0000S d808 40pR  g0p0CS00S B 0RX bf`00000S c00000CS00S B3X0C3 f`v `V`C`-? D00kL  L 0L0 0|0L0 8" -L@ t  0!3#!S@@c t) ?㔝 -L`M4  c_80 0 @Ö 3, S2 , K PNH\ X0,`0Q&2R :"0S 0@C0<0 3 S'08P 4t (8:hS1R@ 4 0"6 d0 c\[ʄ 0R)vze@P 00S fP 0 >.0 Lf0S 1Q0 0000 ?0S0 S;0P l 0D00Q p P0 H 00 0 000 0b00S @ \Q 10 @Z 0 0X@@00S 0A1 Q P00P000{$ 8"@$ 0!000!1 0 ഀ 000s0d0h 0 d0h 0 00<H0Q 0H0P00P0< 408 0 Q< 40 8 ; d0 S5 p2\0   aRbP00P00P0C  0B 0S:P0 0X H00aS࠱ࠣ^  :P' 0S$P30S pcO83Q $$ß0r 3#p000'P 0!(00(0! 0R:2 000R 2 00bS:J,0P 7WN<0S 0S) tP00P000 |1"00Q0 0Q0Ph p0R \! 10Sd0@ S*P0\ \0S  0A  S 00bQ @T 0B 0S:P0 0X H00a^  v9P' 0S$00S pcO0Q 0rph0t p000倓P 0!(00(0! 0R : 0 00z.PPG<"{I0R H3 00bS:+,K PcOH\ X0,`0Q&2R 8"0S 0@C80S<P 0"S t \0   aRP00P000  H"00|Q0 0Q0\Pj p0R\" 10Sd0@ S*P0\ \0S  0A  S 00bSQ @T 0B 0S:P0 0X H00a^  8P' 0S$00S cO0\ 0Gq 000 00尒P 0!(00(0! 0R:H0 00 0R $0 00bS:*< <" {z.P(M<0SH -LpM@(   0a7P00000S I`000`00CS00S +?(K 0p0000S ^`000808 4R  c00CS00S ? 8" -LpPco4MC00000S `00000CS0x0S >@ @ @ L3, S2 @, K@PJH\ X0,`0Q&2R 7"0S 0@C0D H0 < 3PS8P '0}P< J88 80L 0Q80 P y0tPS d0D@cTeʄ 0R0 P2P b@P 0S P P0 >.0 b0S x1Q0 0000 ?0S0 S;0PUk 00s0 l 0D00Q p P0 H 00 PP0 000 0b00SPD@Lh T@R0 0CSR0 0CTR B@000 s0dS?h0S m 8"(8"^$@$- d0Q0d0#Pa=?0 0P  003S0K 00 HT 000 0\6l $, 44< 00"l04ꌠh0S m d0Q0d0"a=?0 0P  003S  LT KX h0S0d 00   De ZN T 0SX0  10 TX 0 0Y0X0S  YT XQ Q0P00P000X 0 YX-0 S P AP 0S 1Q0 0000 ?0S0 S;0XL 040 :isT@!^==?04K 0P  003 S b2b217c! b0B!6  0G S-`T$ 8"@$P"T 040  4PDd0l $, 44<00"l0%=?0 0P  003 S b2b217c! b0B!6P KT 4JZ d0 0d0h0 0h00 0 d0 Z 3S3TQ X 0B !000 X 1 0 ഐ@ 003S 0!000! 0 S* 0!000!03HQP00P0P H P 0H 00LH0Q0L H0< RF d0DS;@8\0   aRhP00P00P0C  0B 0S:P0 0X H00aS࠱ࠣ^  =5P' 0S$00S PcO0Q 0m0 P000GP 0!(00(0! 0R:X0 000R 40 00bS:j'P"z.PZ<"0UD3qIH0S 0@S) tP00P000 |1!00Q0 0Q0Pi p0R \" 10Sd0D@S*P0\ \0S  0B S 00bQ @T 0A 0S:P0 0X H00a^  4P' 0S$00S PcO0Q 0/mtl0x P000噎P 0!(00(0! 0R :$0 00{z.P]<"0R $3 00bS:&,K+PcOH\ X0,`0Q&2R 4"0S 0@CD L R<00S<0 vZHP 0l"S @t \0   aRP00P000@  "00|Q0 0Q0\Pk p0R\# 10Sd0D@S*P0\ \0S  0B S 00bSQ @T 0A 0S:P0 0X H00a^  3P' 0S$00S cO0\ 0\l| h000 00ōP 0!(00(0! 0R :0 00<" {z.P`0R 0 00bS:%x0   0S [000808 4R  '_0 00CS00S T:HE<" 8"(8"dQ0S 00C0 0 000 0b00 00^H0S @ x0   0S c[000808 4R  ^000CS00S :  8"(8" 0-L@MPQc^?0S  S, 0S0Sj% ^Ϡ0 00K;0T00 K e@!00P  0S '0  0 -L`P\0p\ cOR R 1H 0bSkk 0 #0S0 0bS Wڠ0 0SX0S`V00W0S '0 0 0S0CH!@TY3P P`#V w:` -LPD@K MF?@ 4`KDqbppFA0000S Z000808 4R  ^0p0CS00S B9\ \0R \00000S EZ00000CS00S (9DDQb00 8" 0-L@!t1c_0t1 0004 4R 0 0C004 000Q4 00CS00S 80L00@$ 8"(8" -L`cM 0q0 Sjb\ 0p0C00000 4]J\\,K P D 0 b d0 BR: @  P@T1 , dR*^?0PbS t10gSP1U" 00 Pp,00,0 , d0R 0 0\ 00C0 0 \0Sq Z    -LPc$MD 0 B00000 S rY000`00CS00S T8 0j8 S Xk @ <40 1,K4 ,0  3Z 0@ 1r 0!3圓!c0Sj@|1|Y | 0S0<0 ^?0S 4t!0RYm=?00S @ R ci\0\`S@@T 40D QJ 0 d0@X:/i@T<Y0S; Y 3S6 0S3 '00@ R- =?00S(0% 8"ȥ0S3S'0 0S @\ =?00S D0DSQ  "=?0D0 D000H0!0PR "Ii<0SJ< Y0C0000S X000808 4R  @\0`0CS00S m700000S wX00000CS00S Z7@@ D0S P0Z " ax10x1 1R <0S $P0Z T" a|10|1 , 1R P =?0 | h1,0 ~`h^?0Z `1S t10aS *S 0S04`V0 ` 00 0fdP4 f000y ^0S !t10bS0 S0S X @0R B? X0-&3!<4<!4"<0d 0S,: 0 00%\ 00C0 0 ([4000 \ 00C0 0 [$Z 8"@$ZD0S <0S Y 00P0zYP0ZU,0 (R@  00C0 `逆! 8"`$\$ -L@ 0S2 P 2 p-@ 0LS g0Sxxg0S hhg0S 0SLwg!0S 8{g 0!(00(0! 0!0\P x0S 0!x00Cx0!SZ R 0 0C00P 000PP x0S 0!x00Cx0!SY `R `0 0C00P 000Vp p0R &g0 St0S g0S gPP ۵P`TP յT` 0!00C0! 0!(00C(0!STp錧i̧jm<S XLY`! -L@P Mb00000S /V000 00CS00S 5 0'0 R2 0@TT0S@00   0@0S 0x=T1 R@  00C00 0 0 0H B0 c@CY\ \R 0 0C00\ 000\0 ST- 0 " " 0@TT0S@00   0@0S 0(=Tp0 pR@  00C00 0@20S Q 0 202 8"\$`$@$>P z1ZP ?D@K A@ 4pKDu]`` 037 q`p0`0! jS ! 00`lp+ ?0 쀅ppppHPHU 0Spp c 0!00C0!0S 0S88cQ40t -LPD@K M?=?0@0 4pKDZ?``@PT1#Q0B S @lؑ86S0  =S2 G?00 t30S00\30S00!R <3 83Ã!R(3 3à 3230S2U?0S20P 2?2"0?2cp0S  B02H12?>@PP>A/PK lm0q SKKKK K00K(20S0[00K20S 0[00K1B 0 020~0K100[00K\T1\#0 T "c11$ 2|0 \AXQ``q2b!!" `6x p l h@ dP `` \p t0 ,0X  0c10 `P0 `0Lt L H0 2b!!"D x0!@ "c112 #1<0 08 0n4 00 , =P=?0 0  003S+ K%"0S00&[$=P  !Q! !!\!<" UR=?0 0  003SK ;\  -L@?P!0  RR010#!0 -L@0"00$0 -Lc?6 s?R00S0Քh! -L0S0c\3\3L?@\0lPP @?L\d0^\鰆! -L`0cπ0s/ L00S0cRRB000Q@0!S00S@0@ R!t! 0-LP0cO00 1 @R0bP#P"@H1S :0H!P 00RR0BQHH1d00S X0H1S0S0`SH1HLH1 SL1L000鰆!!R<" -L0222 2 0-LP!P 1c Q d0PQU 0@ @R0 00S 0 0QX0T@@@0X0@ SX0lS0 a\00 S ! 1UH1RH!H10H!0SL1L!0t!$$$R -LQ1S RA0 Q111\1 p-`c_LQ% 00!0aS$:R" 1!0b!0SR d00S T@>P0s?800@ S0S@01 101p<"І!Rt! -L@ 0P0 0d 3`R*0 0a R*kR 0+ 0 c R## 00 0\ 0!0bS 1 l0 0101$1Qp`0$0,0 cR00$0R*0$0S$ 0RI0 S,p P 0S00 Hd\,LH1P(*@ X0 cQ0aR#R!BP00S0 S0cR3R3B SX00 >P L1H! 0 QLL1! <"U!$R -T0L R }?111((0 !0 ̆! -L1c0HSv\ h R100\m 0j q0StP(00a40(@ 0( `Q4401C40(0  Qax0 Q1Q8%805 a0"1C0805 1R R (0@00S<0(0(0 R@ #Ql0S(0@0R< %<05(0@0 00@0(0@000@0< R (0@0S<0(0 nH0S*00PHĆ!<"! -LQPQ,0Q0Q P!G -LHcOQE h R@100(0(1:0S *0S R n0S 0  0n0 0S% t RS :St0 x0RR0!03x 0|0t 01S00KS*h00S D000<0 Rt0S K?t 0|0x00<". -n0LQQ00Rn0d 000T00SD 000 , 000 000 000@$ -LcO$M< , ,Q 0P0\00 Q0C140 `@ 4`!Z8 p`@0S<4<("4 <4<("4!̃D D,DT0`S "0000p00!4 R 0,$,!$#, lR00,$,!$#,D0 bRP"0L000p00W 00lSl10lSp10Cp1\000c0cS d1p0lSP p PH `D0D L 0bSH0 0cS00L0 L0  H l10bSp10Cp1H 00bS LY W UPT8 VQOUPL  T00lS<0S 0lS< L^< +R  Q00Q0X1 0C BX1 8 00SVUP Q00Q0X10CX1Q0 0Q0`!\1V0\1`a@$W  UPW Q00Q000C00P H0P D0Q0lSu@4^@ <QE l0SBp0Q> pQ; D0< 0cS6H 00bS&Q# T<  0bSP10n 6#< 0cS0Q000C0Q00S X10X1Q0 0Q00 000Q Q D0<0cS`!W 0U0*l0S Ea k\1ShhZX1SXXZ0SHHZ A0rZ,,Z @$Lstܫu(v -Lcπl 01R d1R 6S(l 0S20#! R!@1@!0S 010S 2R2b0#11:021 0R1B00S030 00p10l!p R pR Q0}0Q0 0R R00S 0X!\0bQ\1%}?0W S  118 4 10 0l1V$!! -L@cπ\AXA`Ap0Q pQ Q0@Q H 10bS0Q0X10X1\1`A0\10Q Q00S 0X!\0bQ\1%W/ 0  c 01n0p 0000`0}/l0 S0!Rn0<08!0l0d!00 <"!U -L000`1\1X1l1p1 -L`cOpl0S d1R 6S9l 0S20#! R!2"0PS !19P3PPU10S 10S 2R2b0#11:021 0R1B00S030 *d1 00X0l1p 0R# pR Q0p0S0l1Q00Q0QX0!00S 00Q0X10X1\1`q0\1 0R R00S 0X!\0bQ\1%W/ 0}/0h0n0 S0!Rn0L 00D 0l0d!00VȆ!$!!<"!U p-L@p`Mp0PS0S9 Q06 |00|0=m00m0pQQ"c_0\pp0 00XT\ \000 00:zP 0!(00(0!@$.z<"p -L@X1`S20S\10`1n SP p p0S0 L0 cRX Pe10\!S01R]:pWV c_H\ X0,`0Q&2R 4!0S 0@C p0R1  R" 10 Sd0 S*P0R R0 S  0B S 00b SQ ^ 0B 0S:P0 0X H00aϠ\Q <"! { -LX!\1R 3\ 10 S 0b \1 -L@\10\1400S 0X!\0bQ\1%W/ 00 -L@R\0AS0020a0\1400S 0X!\0bQ\1%W/ 00 -L@P`pUWp 0R p Q00Q0X10X1 0R R PUJH00cS<00S 0X!\0bQ\1%W/ 00| 0-L41@0P n`!d1 lR ӷd1 0 S p p0S0 L0 cR  R( p0\ p\ 0L 00bSQ00Q0X10X10\ \400S 0X!\0bQ\1%W/ 000<" 0-L@0*0PS !17P!3 Q0 0P: 0S0e0 0B $0 0S0 000Ȇ!<" -0LS 0S0% 5Q  Qh 0Ї00 0S0% 5 0B 00 0S0 0000VU<" -L@l1S p1S h!R 10S 1S 0bSP Q l0S 000 0000l1 d1R00S 0B t0 0S0 00}?0S 110 , 10 l@$<" 0-@l1LS pQUg lQ0000@$ -L@00S n `1Sl1S p1S h!R 00S 1S 0bS\ Q 0Sh1D00S\1` & 000@$ 0-L@l1S p1S h!R 10S 1S 0bS\ Q0 p 0R pR Q00Q0 0R RP\1XQ0l 0h000mPlQS }?0S 114 0 10PlP00@$ -L\1Q0h@> l0S1 81l!0S 10S 2R2b0#11:021 0R1B00S030 0B 0 d80S0 (1 0000}?0S10l0l0S2 0 S0Sl1S  l0S }?0S ^ 11  10l 00 0ld1 0B @0 0S0 00 V$!!U<" -L`cOMpP0S\1\1S`1@, 3  \1S 8P 0d0lSl0S n0`!R c 0K #00030S 0X!\0bQ\1%l0W S 20S0S U0h1d!0bS}l00CSxXľԿ0m0PMlQj L20PS !185P3P00S0P0U 0S0 }?!0 S 0l1S 10S  d1R9 }?0l S 11p! l 10l(41 RX1\!0P10PS !14P3P00S0P0U 0S0 000l0S S( B0X l0 0Z0R0S [@0 0 PbS i V@$!ĬȆ!<"0m0P 0B 0 0S0 00hl0Sl1 R0SX1\!0Z l0SgP 4y00S t00t0 x00x00 l0 Sdlp!9, R  0S2 0#! R 1h0 d00S X00S 2R2b0#11:02,0 0R1B<"@$V$!!00S ! 30 00}? }?C:R |0 0l0Z0 S p p0PS0 L0 cRP XU<" -`1LX1!0bS 1^54!0^ပ!00\t0S% L\ 0t0x0l#L1\x0#Lx0| Qx0|Q 00bS|0 S0c0#1B005 01t00x0 S030|0 D0t 0!S!0q0t 0 1S0<"Ȇ!. -LTP10S 1\54!0\!00^t0S% AQ0t0x0a#A1Qx0#Ax0| Qx0|Q 00bS|0 S0c0#1B005 01t00x0 S030|0 @0t 0!S!0q0t 01S0Ȇ!. p-L@1PaQM`(3Pa 1 ^!501 ^1! 8S  0R(0%1 3 0aR *00P0000S0 00PF00P!2P0*0B0L 1100 0R00 :S0!$ S03000p܆!؆!Ԇ!<" -L`pPp0cO衟Mp R\N0``h!P  00C0`pW0pc\10C\1X10CX1  T0S  |1 c/ W0pc`1S0C`100C0 00C00000  000 0b00 00Dp p0R\ 0\ 4 0 b/ : `00S 1S ZW R0 #<"{z41 Q$$1 0 0Q!00000@sP 0!(00(0!\1SQX1SQ0SQPU00S XQ tl QXQ\Q \l Q\QQ Dl QPp .zLN O ܫ0 0-LPcOM0X H0 a/0q  +zq0 #R1!\hh0 00`QLT T000 00rP  0!(00(0!.z<"0 p-LP@ `,$( , "B?000fST 0aSQX0^\& X0PTS! 0XS0S X @0R^?0S B? 0-&>#<4<!4"<0\0^`\`p -L@0cτ0S 0X!\0bQ\1% W@R 10cS1S0 0n0000 R !00n0<0S0 001 0/B 0b1<"VUUU -cOL 1!1!b !1c01!1 -c0L` -Lc?$ 1 S 2P#3<" -cO1LQ 1S 0 !01<" 0-L@PP 0 -L\0@cO1 0\1! Q00\03S <" -Lc&101 0-LPPcO6Q 1S&!0a 1%!%0c0150315010 -LT0@cO!10Q1 R00Q03S !<" -LPcO` MTp 0 0gS0 D[0bSQ 0gS 3Tp0S #p0`0p0'H0\`p#l00l0 0Q0`S 0 ` 0 0 B0@S30 2R0@`S 㠣"匐0 Y0 ,K0 0cPE1` S 0  `l0S  Rv n \20S0Ug:@ 0R*l 0S2QX 20, S O0Q:Q0205C10ZS1 2S!0 "0bS'|1!0 20Q"Q *0a#1 SS10#1 0Q1000#11:`0Q*b/22U:: R02050:0:000 00ge 0 R0U^:R,  AW0Q:Q0205K(00ZS8Ȇ!@$U<"$!2SH!0 "0bS'01,!0 20Q"Q *0a#1 SS10#1 0Q1000#11:`0Q*b2/22U:: R02050:0:\0004ZHP hP,000 >R (<"!Q0S 0 X 0S  0ND -L@M, 4 0p#21CX0S SH `VV0CS񟗋 V 0Y000S{ "48<#8u G R R016mVk 0Y000Sd <10S` 0!00 B_0S W_xP 9N00N VLY A?0SYD00S@ 00<4<("4!< 1<4<("4!<1,V* 0Y000S# H00S < <<00 0C000!\!!Q V 0F(00S0, 0cQ00FpfX] p-LP @D 0T ' H0\$0\!0R`BT 0lS"48< #8"\X0R`V 0!  5à `RPPpQ 0-@ 0L0SF S S o0 0h030S 0PUU0 R@  0000@0S 0A$U\0 \R@  00C00 0+ 0'0R00 8"\$`$ p-@co 0L0 000'0 0 B'0 R3xx((( 0S1 R@  00C00 00C"0h 0S1 R@  00C0 0 0 W 49 DMP x0S 0!x00Cx0!S? R 0 0C00P 000P00S 0 0 S20S'0S 0S P 0S L 3pP 0S ( x3p 8"`$Q -LPpH0D cOS. 00cS*`H00H0W00S 00S H0D `R0cS0000000 D A$0> 0 0cS00@$! -L~0`0JOV700aS 0bS0bS00`S00S P0A0C0p0 0 0cS0 PV0 !00^`p 00VQ 0-LcP1P@U> \+00aS 0bS0bS00dS@00S \ 0L00@ \ U&0\\t L0@0C0\L \ @< 0A00(0 0 0cS000Q -L@JoPQ0 00pW 00cS00cSKQ 1CJ? 1QPEp`< 0U AP(0 0 0cS00Qĭ -L`c_?d"pR@@T D00cSD0gS<H2 lR0 ppS"10S. 10S* 00cS!000!0000!A $0> 0 0cS0000`S ! 0bS0bS 00lSH0lSV 0S ,K 00C00000 =%V 0S D 0K 00C00000 \  00 @@H00 0  0R@@T D 00bSr!@$@ -LPpcOD H0 R 0#2d0h 0aSd0*H000 0|#000p#0S 00A?3 0 L0cS0!0D Q 00S0CS =D?0P61S3PQ0 00S- ^? R)d0Q`1`! "00CS00S H 00FPP0!0f P0!d0V 0;4"000Z;Z!X @0R ʀ0`Q P `VPa0`Q P `VT 1 p00!X00X0!0 0b\ 0 00 PPH00d0S  ( 0  `0S 0S"000S ?0S0S X @0R^?0S B? X0-&3!<4<!4"<0Z<0QUU(8" 8"D4QH00cS+hH0d#0H00D HS H30S 00cS0000000 !#A$0> 0 0cS00j 00 0 00S0C00cS[D 0aS3W 0S tH0I\2D0S H20S 0`S("000"0000  "A$0> 0 0cS00 0 0S0CS  P 0S00 X @0R ʀ0`Q P `VPU0`Q P `VH 0  0 0W 0S D H0.I0 p00!X00X0!0 0b0\\!\00S h Pd000D0(1H0,10000@PP@$!lUD4QDH0H`X0 0PP 0X000S ,1S,aD00cSPؠ PH H0aSD0fS|;20S 20S 00cS"000"0000"A QD00hS"t20S h20S 00cSP"000@"0000$,"A 0> 0 0cS0000PP000H0cϰ8 10DS"10S 10S{ 00cSt!000d!0000T!A $a0> 0 0cS00`00`S[ !0bSW0bS 00fS`O 00C0 0 0DHS'00S3 |00S/ 0 0cSd 000T 0000D A $0> 0 0cS00Q!@$00lS !0bS 0bS 00nS: P D00fSr00S   -LpPM0 U, 4 H` 0@0C0 0 :<"0P00 0 020 S0cR#R#Bd0RD00gS 00S D0PHpP0 U00U 0 00`SB`F>f 0J 0gS1Z9@P 0 0 0  !$0 0b0$0 0 0b0 0(0 40b(4HpDp0 P0@@ 000,0  00!,X00X0!0 X0b0LH D0gW0C0EQ%ڌQ``h0S cE@$!D4- d0Q0d0 8  0O>P00fH0p0H0H0c 0`0C0 0 9P@ 00V00 0 0X 0bS@$Z -LP?Md"cR@@T DHDH0nS࠱ 0bS@`T D 0`SH 0nS 0T -L@coMT 0S Fq000X @0R x10S l10L!1SL1L!\001\ 0 SX @0RHP R0 000 x0S 0!x00Cx0!S09 R 0 0C00P 000Pt00S h0h h0 SX @0R0   00̮@$$RQ -cl0LSP 00S!3\*l 0S2  1 0S !0 00000000<" -Lc0S*0|00Sp0p 0Q&n0s/0S01 0R400S0Ք $000 $$$h!<" 0-LPcOM0X H00aS 0B 0S*0 P- 0S*00S&0\pp0 00ETL X000 00(gP  0!(00(0! z.H<"0 p-L`!cO"48<#X p10SPE<4<("4!<!P bRL00cSH^?0S t10eS@P  o` oP 0S ,t!1R!^?0S 0S0R  \\0!QQ H0cϰ  00C0 0 7^?, ^?CtQ0p鴆! -Lpd0c_`a 00CS00S ls0SH 0@H @B@TP0!0f P0! 000(8" 8" -L0\ x 00CS00S ?d l0<" 4 000d l0 <" (8" 8" -L`cOpP|ßM + RKD 0RG X!<,<4 8#4 !0 S7 <4<("4!!< 10bS<4<("4!<1"P2P P 0R 1"101\ H0  C3R:d2 l= v47xQ o0S/ 0o05S* 0' R$=D?0Q<!0R8P 0hS400S1  !P* X 0R 1l!101\ H0  C3R:<1 ld0h 0hSd0*\B0H 00 h0 0h0ZVs0 S PP X 0R 1 101\ H0  C3R:\0 l 0R/< d00d0d0h 0hSd0*B <"<"U@$0\  00 00 PP ` 0!X00X0!0 0b0H00 T 0R  xQ o0S 0o05S 0  0) Z !0S "0SPcO0 0bS 0P *!0 S "0S  R Z9 6 0#2P,:s0S mPP! 0 PR1# A?0S R 1Rx1<4<("4!< 1<4<("4!<1 \# 10S 1 !0bS 1 ~9 ;RRPP 0 <00<0l H0D0aS0 00S0C  ` /R 0S 0 YD4 <"@$20S 0`S 10cS1h"~9 ;RP201 0 D0 0bS   Ÿ00 0 00 * 0 ,\ H0  C3R:1 lq 0  ^0 S# p, <4<("4t!!< c !d0`Q*% K09Pp%0[<00QxQ o0S 0o05S 0 [ 0+ 0 0bS 0P*!0S "0SPd2/S0S  Z <"@$@$<" 000004@$ -LPpcO` Mⶆ  T 0Rr30S P 3h!00b bSl#580502805`: rF @  0@S00D0,T0D000D000 "48<"#8X0D0T0\H"B?PHH!20S A/00 !00!0|" 0C00100` R T20S00`(2&0"KS2K"[1"[!00S0!S?# XSX033! 0S 1 R@  0000 00x000S Q|1B?0S  X0-& <4<!4"<000`V P 0S 1(1Sp0S"0S 00 0 0$0,  00 000(0bP 0!(00(0!4<"@$U R<"! 8"`$!fP 10S 1!0bS1~)0 +S 00SOM 0SX1 TR@  00C0,1 0S A/ 00 00!00D000D000 `"48<#8X0D \0T 0&0"KS2K"[1"[!00S0!S?# XSX033 00S00 B?  000C 綆 t<" 8"`$RUB?  0C 綆  -LPcOpM0 P P x Pv  0 PH30 !!!! }>11!30` aaaa}>11! 0 P0  0  ^0 S" , <4<("4t!!< c !d0`Q*) K0j7P`)0[<00Q2xQ Do0S 0o05S 0  0 PR0!0" A?0S R l1RX1<4<("4!< 1<4<("4!<1 dP# 00S 1 !0bS 1 ~9 ;RPP 0 <00<0: H0D0aS0 00S0C  ` /R  0%!<" <"@$ 0 30S 0`S 10cS1"~9 ;R201  D0 0bS"000 ,t 00CSG0xP 01 0S 2 R@  0000 0P 0S !&T00 B"48<#8 A2X00D ST  1S tQA?0S\!0 0C00010!K0Q0K"[1"[!00S0!S?#XSX0331B? X0-&3!<4<!4"<0 0R 0Sx0 tR@  00C00 0H '0R0'0 h R<0000S <"@$ 8"`$R<"Q HD0P?  0 `0r9Z 0@TT3 R@  0000@0S 0T`3 `R@  00C00 0o 0'0R #000Q20 !b2\1\]L0AR 000S  yH * 0R? * 0R6) 0@TT2 R@  0000@0S 0T1 R@  00C00 0 0'0R 0co  ^0 S# , <4<("4t!!< c !d0`Q*) K095 P)0[<00Q 00C S/D0 0bS'0 HD0P  0 `0r Z$ 0004H 8"\$`$@$\!p000 0S4 xQ o0S 0o05S 0  0 0 0bS0P*!0 S "0S  Rd2/S0S   0\F0 -Lc/(H0S D0S11 R p-L`@ 0Pc}?0S 1100 B 00l 0S2 0#! R 10\ 1 PcU\ P%5 00 p<" -LpQ M 4c_, 0匡 30 S 30S30S 0d#0S 0}?0S 0  B011 #  100d 0jS 0d *" .` ` 0!(00(0!2 00!l00l0! ,0<4<("4!<0<4<("4!<0,80J!6 48<#800/ @0@T@C1 0P1 0("("48<#80!0110S ,|!00 cQ:_?, 1 c("("48< #81 , 0O <4<("$00 ,A <00   S000  <4<("4.<0<4<("4$<0Sl00Y \00 0(,!$#, ꐆ!!!P {  A?0S,0 <4<("4(#!<0  <4<("4!<0Ÿ 0S: 1<4<("$0 !<0 0R.J/Y4 @4 <4<("4!<0<4<("4@"!<00@Y,0S 2  B 0 d0 S D0 0bS 3030 00 00 030310  0@0 0d 0,0 c/!0S 0C!00$00#0 0d0 S 0!S@0 0cSH@,0$ 0cS03"050 R@  0000P Sl0S0 E|0l!0S l00S 2R2b0#11:02@0 0R 1B  U<" 8"h$V$!!00S030 0B 0 dT0S0 D0 0000}?0S 00l0\ U<"h -L`PcOMHpPPRp`yPv1 R! q00Sd0 S*P0R R0S  0B S 00bQ ^ 0B 0S:P0 0X H00aS\: Ѐ0L0-P/H0 0d0SH05050PUP' x0Rhh0 0 0:L T0P000\P 0!(00(0! <".'z0SP -LpcOM 0B P0S:P0 0X H00aϠ\6 0L0-%P+0`H0V` 0# t0Rdd0 0 0Y:H P0`000[P  0!(00(0!<".(z -L@pd0 @PW<*`gh0S S8 d0Q0d0!+ 0^ *1   000^:0 000h d00h d00hdp000``d0 V0gh0d00`dph02 1X$ 0!0P*0 0 0!000! 1`01 10a10 0 000`000 ^0`-) -LPpq0Sd0ch 00SQ h0S  0.P  X+@P 0S FP `0 >.0 ,,<Ÿ0S 02,Q0 0000 ?0S0 S;0`V 0 000 0b0D  D H0H0PH 0P0PQ00Q0 X1 0 X1 Q0 0Q00S9s0S6 0@ph0S R7  d0Q 0d0 * 0Gld0S h0S0d00  .l0l $,#44<4000"l0 0s0s0s0L0L00 (`` 000$ 8"@$-- -LH cOR 0 0S 01&0cC60\ cc/\0D0\ aR \D0aS!1 ` -LpM 0cO, S H崆 P X0,`0Q&2R "0S 0HCPU p`0, S R" p20Sd0S*P0R R0S  0B S 00bSQ \ 0B 0S:P0 0X H00aPD d0S P;t0 L0[+P00S00`H0V` 0 1R  1 0 0(8 0`000YP 0!(00(0!d0SH0505PU{Y 0R:l0 000R H0 00bS:0 S 0S{<".1z 0-LcπCP@X0Q c0aRRB0H!S0c^3^3NS0T@?P0!0S l00L!1SL1L!P0L1P! dQ00Q0S W0鰆!$R -L@coMq0PS 00SQq0 S 00 S RQ0Pd , dp0X H0 a/|h0S  0C0Wt, 0Sp 00C00000 匀h0S 5- d0Q0d0D!( s0Ss0s0S ,0ll0 $,#44<400"l0H0H0P0PQ0Q 0 Q Q000C0Q0 X1 0C BX1 |00S\!R0 B\!0C0`1S0C`1D 000 0b00 00)00C05 0-LPHcO\ X0,`0Q&2R X!0S 0@Cp 0R pR d0SQ00Q000C0Q00Q0X1 0X1 0R R\+ 00S 0X!\0bQ\1%l0W S  R# 0d1 0#! R 1 }?l!0(S 0 0l00V -Lpc_@HfP X0,`0Q&2R `"0S 0FaC0 lC1R Q X0D 00cSRd0S  P 000P0d0S* 0R p0R 00S 00S10S  0PpdP P0 H0 0CRQ *h0S0d0  +PH0sl0CD00q 0RL0 00SQ  * )`P0 R@  000Q0 `P X5Q00Q0h!0R00L0h1p1 0p1T !<" 8"l$T -pcOMXLXM pPE 0B 0SQ0*9 4$Pl0Sp"000`"000p0p S0U`42Q  Ÿ052"`000VP 0!(00(0!HXP0U p0Ul0S10S ` VT c_H\ X0,`0Q&2R u@!0S 0@C p0R 1  R" 10 Sd0 S*P0R R0 S  0B S 00b SQ ^ 0B 0S:P0 0X H00aϠ RZpP0>@$.;z<" {Q0/rPDp0p S0U co0Q 040 000SVP 0!(00(0!h 000P0U p0U `1X 0B 0S.>z<"@$: -L`c_pMv0HS@@\ X0,`0Q&2R p!0S 0GqC0S P0H 0 P0H 000!*M&@P  0lP0Q0>Ό00DH?PA  0B 0S:P0 0X H00a^  P& 0S#00S0\ 0>4xp |000 00UP 0!(00(0! 0R :$0 00z.LA<"0R 0 00bS:<" 0-LP%cOP 0 R. 0000 0l P0Q 0 x>.0 0X 0 aR0D0H00L0P 0 R. 0000 8"<$<" -LPp0ppS@@T P083 ?q0 S 00 S R,  '`P  00C0 0 p0 00p0`0p`00 0b00 00>&0 000 @0b0P0 0P0.>0?0P0(00 L0&(l<" -L@P  0Mu!cpP* X0 >.0  0!000!,0 $  0S00 d0iQ 0d0*(" $` ` 0 00R0 00H0<4<("4!00x!>0`0SP00P000Q`l`0DaD000H00 000p L0h1 00 @@0 000 0b0000J$0 R@  0000 Q||0 0 01`h 00000RP 0!(00(0!U!<" 8"P$.Mz -L@cτ$P0 t0S2  Q 1S03S R 0 #0S0( @10bS0bS0 0(>RP 0!(00(0!<" 0-PM 0LS8  {"cOP0$0 0D 0 00%0(0RP$ 0!(00(0!<" 0l P0Q 0 D>.0 0X 0 aR0H0D00L05<"0 p-L@P <"coP 0l00P0QP0 >.0 0( U0CD0H00 L0pp<" -pM 0LS cOPUs 0XD 0 cRlHP X0,`0Q&2R P!0S 0LC X0DH 0 a0`SH 0CR:d0 S P0\ 0P0aPTP0$0P00 L0#P) p0R 쀄0`H0V` 0 0R0 0 0/ 0`000VQP 0!(00(0!X00S 0|!D0 cQ: LI<".Rz{ 0-LPM]cO0S0S.00q0NP\0q 0R0q0ĵq 0@2S1!.0\00 !.T.0S00q0 #2R12#x0\ dd0t/LT T000 00PP  0!(00(0!.tTz<"0 -L P0PPP@c@"<"0 8%> P" |% Ebzxf([ 0-L@c_0  <2S PP 0!(00C(0!0 0#0R PP 0!(00C(0!< 0S PP 0!(00C(0!0zx 0-L@3Sn03 0PUU0 R@  0000@0S 0Ul0 lR@  00C00 0 0'0R" 0000 8"\$`$@$ -L`@c_1q0 0bSV#1R0\0 SVl1l!0QPڷXP P.0 D0bSX0S0S`V  t 0PUU0 R@  0000@0S 02U0 R@  00C00 0 0'0RD 000`!<"]!$$$p 8"\$`$@$ -D0L Q00P0S QRQĩ$ -L` 0 cS2 m0S HP 00S HU?PP+0P(0m 0R HP 00S H0 SP @t0T@@PTm0S"Pm0S!!!. 0-LP00cOS %0#01!D00D0/OPd 0!(00(0!\0 S 0SK H p1(00cS %OP> 0!(00(0!60 0Q !0004 4R 0 0C004 000QL 0 "0S$0 0R$ $00"00$0` @00@0T00S 0 S᧵ 0!(00C(0!S0<"@$$ -pc_⌀LX0S.000 S` q t0S@3@#`T>0SbP>0SV!. -`cM0LS p0p S,X0SA0S> 0S29WP  0.Ġ Ƞ̌@ P,ȠP @P,d2 0\0bS)p Q@H@HT 0S", 0!00C0!Pm0S&l RR10S R!000 !000Rx!000 d!000RL!0000S: owQP .0Q00`1P2PP0010Pe0 SᱲT3 0PUU1 R@  0000@0S 0 U0 R@  00C00 0 0'0R 0!(00C(0!Sp\!!<" !! 8"\$`$ 0-L@D0!X P 0P00 R 0 0 @0$ -L!X@"000U'2B0a\00\0S" X 0C%8qP 0 S PN^`^%X (2 0 B qP 0SP9  R6 &QQ0SQ 0 SI`R&% T &\2 SK?0  Q 0S Q^ \ 0 SQ 0S Q  RR2`PbP* 0S&0S 0 S ` 0S &0S 0 S000S P0S0 000@00S HHG)`@ 00CS00S  8"!!X(8" - 0L00 R00 000000S  R 0 0 0 < ᷑, 00CS00S P 8"$(8" p-`0LS M, 8@K w]?P4P (@KT 000S < 00CS00S ' 000$(8" 8"00I (p 0-@ 0LS@ 1   0S ( 0 S0 0Q 0 "0# "B(" 0B$"0C  01P0S0 00@0Ph  h 0 SD < 00CS00S 0 8"f((8" -@0LS% 0 S 000j 000 R 0S  00 00h00Ch0D 00CS00S 0 S [ 8"(8"( p-L`PP@("( 0S ^K?0 ^00\ \ 0 \ \0S SP`Pp -L`!hŸM 0('0#C8#C4# A0 Ȏ,0  Q4 @0S-0S*0 S' 0S S"Dc/Qz Y 10St 100aSo8008S000@01D01 0!(00(0!PQ@PQ 0S 0S0 S 0SG SE PQ*48 < #8Ạ2R '0S0 00`P,0 0h00h0Y @,00,0T 5X ,00,0 0!(00C(0!S(0!<"m@$$b -PMLQX30, 00 0j<#0000``0 $V00 V0S `x 0C'8@T 0S0S<'0S', KP @T'@P HX`l"00CS00S ab`8#0S0 00P 00@R!!48<#820 0# "0#C8# C4# B00 0S0 00P h00h0,P ,, 0!(00C(0!S41v$!00CS0<0S9 7@p`0000S:0S70S &0 0# "0#C8# C4# B00 0S0 00P0h  h  00CS00S ! 8"!(8"$f f$ 00CS00S (8" -LRLMh cl h 0S`hh00p0 #R 0S YZ`K8 dK<1Sh0Pt rᲀ` @P0VY`@ X T` LPK40KsKᾂKt`KPd0 X @ST 0S '& 0!00C0!t00`K t0?Pd@0 T 0S,0 & 0!00C0!dy0z3S 0S p 0S0000l1S 0pS011020S l1Sd@p 0SQyQ 82$ <0Sl0%% 0%l%1%hpl 063S06l 0S1 R@  00C0 0 07`Pkdr.0#0`P0d0 C!<" 8"`$D||<" 0@TT0 R@  0000 @0S 0 T|0 |R@  00C0d@0 0T 0S@@ % 0!00C0!000 8"\$`$<~ -Lp("n`!0 c, c l $"0l0b6# b c#, c l ("0l0b2# b c, c l %"0l0b7#;;10P@ T 0S00S,0S $00S(0S ,,$PP@Ty7, 0-LP@KO00  c0( @ c&" c b,0b0l6# l c#&" c b,0b0l2# l c!" c b,0b0l7#;;1 C00S0Kc0000y7<" -LMpd 00 00R 04 :,0 @ P`(000"48<#0% $0#C8#ŸC4#  B0!Q 0S 0S0S 0S S Q 01Q 0S 0S0S 0S S Q 0!(00(0!P("0P 0S0S0S S 2S SK?0  0S  0P 0!(00(0!Pd!00CS00S U8!000. 0S  0!(00C(0!S"0Z00S  00 0 0S  co 0 S<4<("4! 0  A0cR *d 0xS>0   40A SWꄄ؇؇؇؇؇؇؇\G L 8"(8"$$@$\$ZZ:0Q 0 S H@T 0S 0 P@HT 00X0,00 R *20 S S(0 RZ03X0,X20S `0SV<,2!q 00SuS3 Sq00S 0 ,K+@P{ (0S #0X!000n, 00c00CS00S00C0$0 P1ᝋU00SQ4a000# 0@TT0S@00   0@0S 0T0 R@  00C00 0 0'0R00S<00 # !,6@$ $@$ 8"# 0!(00C(0!SO p-L@Ps0`S("("48<#8 "!0l0p l !P("("48<#8 ̼ ȜȌ" 0#81p -`$M @ 0LX,00ST0pK $0["K 0#K# [P0$0K0#0K 00,0 0#0K , <4<("4!<0d 00 1C,$,!$#,( @PK0@@p <0 $ X ```l` 8  4  k(04 0 (04 !@$ -LH@K`p4M\0 P XK 0X@ T0 U <4<("4%<,0 L 0T0 D,<4 8#4  ,4 <4<("4!<00 <4< \P;[@$K("4&<Რ(⸤KD0 <4<"4'<@0 8#8#$(,T0"(#K< [;K# "< K[$,$( , P PP\P P  L   (00(0 <"!@$ -@M8@0L0'<04 3 0 0 x K25K@EKTK 0KTKGPV! 0 @ 0R T 0S<< ! 0!00C0! $00$0( $ -L@pRPMpP%  y`P d @l &,"48<#80  "0#81, mP@@W 0S(( 0!00C0!` -4LP  -L pMH" L0D2 ,0$0 <" @ v 0R# D\30Sj H ?#0Q0S_ʌ ㅈ`PY OKP B?P\3\ß\A P PP(K?0K1LH^ BB?#(KPPP PPB(K0S ,!R2  B?(K "0P0PD002 ,1R00A?0 0S   00S  B? 000000S    0<"00@@0 4 , 0S   X@P ᭍P @1H"4@R$0 10S 0 00S000H2S \\0 T0bS 00 008#! aD\B?(K0HBSA 00S= nP8 0S@H s@T.  <2R*0$ 0< S_* 0 0bSZl 40Z040{ 0SIHH D! $V$!!<"ȩ$pl!<"@$h10S63X!0 0cBS/T $0S*Z 40S%IP K0@ 0P0%Ġ Ƞ̌,Ƞ^Z5 0S U 0!00C0!&$0   0PD D2 0FPH\ $0 4և! ! $$0 ‡ 000 $@$ -L`pMP^X|V `Py  " @Ps H`000000,00,004034,003$0\!0c_0縆3S06"81&?>.0#0X0,1d`&0S"K2K"[1"[!00S0!S?#XSX0330S 0 0# "0#C8# C4# B00 0S0 00@0h  h 0S0 000@0<"Rf` L00L0P P0V0P0 0S,, v 0!00C0!@$| -Lpc@M $ 0$Ke P $0 j0la#!$0P 0% .0#C8#C4# Ȍ B0!,0P 0S 0S0 S 0S S P 01P 0S 0S0 S 0S S P 0!(00(0!Q 0S 0!(00C(0!S0嚆 $ 00S4 2`p 0-Ps0LS&0s0"48<$ #8 l ̼ ȜȌ" 0#: GP 0s0d LR0$@a&"48<#8  ̼ ȜȌ" 0#800s0("("48<$ #8  ̼ ȜȌ" !l0Բ 0-D1L P  0@S d0P+0 0 0d #2R6:s0S l0" Q' 0 S P Q   d0P x0S 0!x00Cx0!S0 000000 $@$ -PMrLPl$00$0d0  Bd0QQbrPP p 0#Qd0  Bd0QQb[PP s0S Pw p$<4<("4!0 0 t K25K05KPK 0KPKxPH@0TH0 0SHH  0!00C0!0 00تD0 0S 0S0P 0`3 _ @"p0S H 0R- @2 0pP 0<0C00CS00S00C0/(p000@"1SQP@2Q00- 0P000%<"@$! 0 0 0$00<0C00CS00S00C0$0 0Wx@$ $ -L@`0p 0WP d0U 0S 0S00 0!(00C(0!S8 -LpP`MhcO,p 匀P00h0WS]P  X d0QX0d0"X00F00 00 0S4  h R 0C0S5R ,c  , d0 0d00000 h R0 0C`SR H pd0  0d0`0 0$00  200 00R0 0,`00(8!!H0  8<@D0S0A104000S0m0 00 0b"c11 c02/S00S?0 00 0b"c11x c02x50S0S 00>08 05 0b"c11 c02-<"zQ0400!0b800 0b<05S 080@05S 0(0, D0R X000000l0 0W{ ,2 00l00m00>00q0  0A?0S0010S00010S 0 00B?0 000 0 200|100000"c1120$0"c112 0603000\10X1 00$0`1(00 0 0c10,0,00c104000c1080`0<0L1@0t0"c1121D0x0"c112#1H00p L00P00T0n0X000h0d d0bSh0S 0d0<" UR  -LpM0@SO( 0PPE , sr00s U00S A`P  @0IP00d0@ @0WPU 0S 0!(00C(0!S0Nv X$$ 0!(00C(0!ST -L@R@U`p !JPT 0d<4<("4!!< " -LPQ`k0S_0,(L`` 0R3#P 0RJ0#$(,"QA0#$(,"Q8010#3pq 0S0Q "48<#Q"0S  0 S@@P2 S0S0S 0S0s  tPX00 cPZZ -LQ R 0S0QZ -Lp@`PV10S'`0S 0Rʲ0S  0RR bP 0S 0R0@PcUU -ML0 P04P p, PRLQb34 0SX 0!000!0`V@ʄ304 V 4 APT3 4 U,40 ) 0S& 2R R Y  AP , @0P 0!00C0!S c@PT`V 0!00C0!S NP04P 0P 040;0S,0d "0` 0V00 4VÆ14    @PT5 40U. 4 01) 2R R# 0R RY  AP , @0zP 0 0PP0S00S300 Z裔K8 00 0 0p 嘠 PKSt100x0KlK K0lK#30#0,fPj 0  0Sb 0 y 0S 0 R40S0040 P00000S 6000p00CS00S  4 K @  0 P ̓ \$\ 8"d0 ᜂ0000S 4000808 4R  00CS00S 0S ,tp@T 0Stt  0!00C0!X R h R40000Y#20#Pv@0<" -L@ s# 0-LP 0@S%R#\<bQP PPPP00H@0H0T 0S,, 8 0!00C0! 0@t -LpP` M0 _L, EQ00  ᑇ, : ,0KM@P4 dV0 00` 00 00 P, "0S  0Z=  0X $0 003S ህ d000 e,0P  -L0cSv -LR@1@#c=?0 0  003S @T ]T  p-L P`@0PPESPSP=?0 0  003Sc \ PPp -LQM@ @凇 R[0^S   -LQM@ @ R[0^S   -p0LQ 0Q l00!\0\PPd00!T -L@8MŔp \ 08``\ 0(P P@ lX(000 0(00$`,P4@  0ꔶ -L`【X@M 0 ʴ `p0QU 2SY @K ` `VPUpW 0h0c`c 0V` V0`$ -L@,0xP P  -L!"000QIbB 0R0R00tR pr0 1S0\ 0b0*  R0SP ^0\ 0b0 (8#"(Q 0S0 Q0S  ^ ^V 8#+!0\& 0\0R0S 2 SK?0  R 0S R  R 0S R&0S, &0S) \0S0 0 S0 00 h00h0 0!(00(0!l 00CS00S V< 00CS00S J 8"`$!`$(8" -L00 - 0L00 R 0S  00 000h00Ch0 0!(00C(0!( 00CS00S  8"(8" -L@8#8#Ġ Ƞ̌8 p`P!,Ƞ#^- 0 S' QK?0   Q00R R0 R R0 R R 0 R R0 S@ S@p^`$ -LpM 0`P <01@0@P 0!(00(0! 000I 0F S 4       (q`G` Ud00S$ Z` q`U@!00` ,00 R 0S $! 0调c 0!(00C(0!S -L1c/S 011 -Lppp0PS@ @ Tu `101#$(,"( 0 Ssa 0S,s0S0l0! "48<#8  "0#80Fl l! "48<#8 ̼ ȜȌ" +s0 S  0d a aUlsl lp@T l0@01"T! "48<#8 ̼ ȜȌ" 0#8S0 n~ 010 -L!! ̼ ȜȌ"  -LPcM 0 S0   RY#*0 ^0, S1 C00000S 000p00CS00S {`VF0000S 808 40`R  000CS00S ^0 0R0  0S 0S S^ p  00SX0 p 0 R40 0 4KÁ`P u,0` 0S00 ,0S3,0 4,p 4p Q 0S W 00 =>(!0 `R 0Q 0 ` ""<S 00S300 Y蓕 P. H@T 0!000!" 0S 0 PH@HT 0S44  0!00C0!00  8"L@ QH@K8 00 嘐 `K0 0 x0K2K7KlK K0lK#30#0``P0 ` 0S P Q 0!000!H@HT 0S#= 0!00C0!0 40 S㐐0p40 B00000S |000`00CS00S ^0S! 0000S 000808 4R  00CS00S @,P `Cp  !21000 4 K ! ! nj y`P P `8A0000S K000808 4R  00CS000S @T 0S  0!00C0! R ,yjVt ,00,00S h RL0000#20#^PK`L`  8"hd $<" -LP(MacH L V D@K  9,0 @Pa00000S 00000CS00S @T 0000S 808 40@R  A00CS00S oH+P #[HL  0{@_t!0000S 000808 4R  00CS00S DHL  00T 8" 1R 01 @T @0000S b000808 4R  00CS00S  -t0LQ 0Q l 00!\0\PPd0C00!T -L`P M00 \00    0 ,0K@PR d0pC W0 p 00s0S 0  d l0" = 0,  p, / ,0S'0S  0=  0X  000$0 003S ~ ,p d00C,0 ,3 000& 00!\ \0S0T 00C0 0 00!Q x0S 0!x00Cx0!S00Sp ꀲ$ -LRpDMh h 0S`H@0H0T 0S! 0!00C0!h0 匠0 SX䃗Z裗`K8 L1C0@@d0Kl0 h0R`>0ZY` X T L@K40KSKbKl`Kf]Pd0 X @ST 0S 0!00C0!l 00`K l0]PEd@0 0ST 0S(4 0!00C0! ,LT0S000Sd000d00h0H@000 0T0T >>H 0S,, R 0!00C0!<"L  p-L@0 00``` ```00@bHPH`U 0S((  0!00C0!pL -L -Lc @0 RT bT2\0S \0S $0#$(,'B"("48< #80d0 ! S:\ h 0Cd0S*D00 020 0(P U -LPU@c P0S  0cP2`0S ,00 0TPP `Px0S 0!x00Cx0!S>0S wPx0S 0!x00Cx0!S& $0 R956r0S3 S1 0S.x0S  x0PS 0!x00Cx0!S/@P" D 0S  R 0  00!꜖$4x0S 0!x00Cx0!Sp p-LP`|M 00 & (@TtVU PP{ T K $0PhpU!00j Q0t0db0 0U*@K8 0t0K PKKPKS@PE@TP 0SHH 0!00C0!U !6R ,!p!(h>@K P $ P@t  R 0   @ 0!400C40!ST!p -0L0S -L@p KPM0 0 `P& @000 (  00CS00S 46 1Y 0!400C40!S@! 8" p-LP|M 0   (0sK ^S8U0PW Qt0RPU0@K8 0t0K PKKPKSR`P6@TP 0S88 1 0!00C0!U!!p!(A`Kl 0@P 0   0 ` 0!400C40!S!p -LP1`UDM 0CU ,1U)-? 1:0<0Qq D@}?p 0  003SdK @dKT \6[S_XD0` Q 0<$,  < 00[S @0KP< 5[S65KD0@ %[6R0`0U@+ P0U 0CU #40U dK@dK6@TUdPK@P D 0  003S \ @ -LtM \K   0 ip1   |0 QUb 0 `㸦Z Z00Z0S (HK0P( 0 #2H K0 0000:00Pʄ0\ ( @0!0Bd e0fl@Kg%\ 0 xHK` p0Wӌ0W< 00CS0K0SH CF 4 8"!(8"PU$!00CS00S .Y^? QU& ` VḦ 0 |@K  0 V @@0pWӌ0WPUYڀ0 `0bRX0(8"!̺ -LQ C! -L ! -L 00 S0P-0000 P @100000000 -SS̺ - 0L00 8" -( 0L0CS00S (8" -LL0\0` 0c 00R` \`0`0S390n`0<" -LPDD 0"S00300 R  000 8"@!$ p-L`M`0 X0l $,#44<400"l0p -L@p@0M   00  0i0p p0RPPU Q ` l0 01"p Q  0"  0s0l$I -LP$`pD!M,00 `_PiI@Pf @w$0 03 $@ (0S,  0$` S$@K8 0唀 $ 00 0`p`K00KdKKdKOP3 0RRS 0S 5  00S2 0$ 0 0RP0P/ 0 0#* 0RQ 0!00C0!T!0 0R Q 0!00C0!T 0000Q000h 000@00CS00S   sp|!P ĵ$ 8"$ p-L`P@!!^ !ASK 0S ! !ѲUPPQ 0!00C0!_Tx 0h0C0p0S S PPp 0!000!P0S00p|!P=ĵ$G -L@P P 0!000!@ p-L@`P !^ !ASMK 0S ! !IL' R 00& P 0 p|!P -L`H!!^ !ASK 0S ! !PPb 0!00C0!@pT' P  PP PQ  0R 0 0# p@Tb|!Pq -LPp!!^ !ASK 0S ! !ѻ\\0 S0S!P `V`Phh@P 0S0000000 0000S 0c #<4<!4"<0 0S000S000000 0!000!`Q   |!P -L` PHK8pKDMM?@`` h 0  003S\  PPU 9PKXK:Pd P{\ ,B0Bl S,xjLjjLjjLjjLjj5[S00h0 001:0 <0 R q1:0 <0 R 0S cR!2DPPD d R:00@T" h0S  ` `` `0`V PT  0RV  ` `` `0`V HKP3\ 0R0V0S h3Rl 0BS 8lll ldnl0n,ln0000 0000d0S Vb3[` [B 0 <4<("4!,0Z1S0 2S00SV C`Ph d RHK 0S ` c 5+0 0 <4<("4 ,0Z1S0 2S000 R 0b #<4<!4", 5 0S 0 00 00!0C0]w 0Rs ` 00j 0Sf 0 0 <4<("4!,0Z1S0 2S00S` 0 0G<4<("4!<   R 70S2 `0,$,!$0#<   8#8SA(A$A"A!A a 5 0S 0 00R0000B  =?0 0  003S HK \  -L` M0pS. PU* *V# X%D@K  ) %0 3K=?0 0  003 S0 DK \ ` H pPU -L P0 \P 0 0SQ 0 0!\ `0 R P 0S SP 0 0 R 0-LP@P=  \\0SU%\ 0 0,T 0 0$PU^ T00\0S 0 0.  R0SPP ^ \\0SU U0 -L@PP`p P @0@T P  0P0@T  -L!$ -L0$ -LM X- 8`Kp@   Z :jPP 4Pn@ @T:Ľ.@`X p-L`P@!!^ !ASSK 0S ! !O00-Up 0D S@vvvvuvvvvv001d0CS.0V@P 00 00  0!000!0 P0`000 qd0CS_p|!PȽ -L@Pph`P00f0S}P ( d0Q0d0"ZW0 0 p 00000 00000000<00 0S h0S  0C0SI 05 0S h0S0  0CS9 0% 0S h0S0  0CS) 0 0S h0S0  0CS 0 0S h0S0  0CS  0 00f0d d0bSh0S0d0  ,-Xw -L`0MPp0 W,0  ,0ZQ @PT U 0@ 0;P@PT0pWPd p-L`PM@P0 i01) 0`Px0S 0!x00Cx0!S0 01 $ 0LΠ0$p -LH0H HP000$\ 0S0\6p!! p-L@MP`T@ P 0Uꔍ!0U 6!p p-L@MP`T@ 0S 6p -L` pPRQ R.P#0X& \W @PT =?0 0T@!  003S  PP t6 -L`pP`PM@P3  ᕿ  0 \0b0$ 000,Vxc<0t3| 0t3x#B΄G 03?3?##84D$Ą$PML@ !p! -L@LT 0L0M 0-LP\@ x0S 0!x00Cx0!S R 0 0C00@ 000P@ x0S 0!x00Cx0!Sj R 0 0C00@ 000P?0S 0S  00S0X0S l0S 0S 0S p}P ZMH@T 0S<< o 0!00C0!0逿ܿ,| -@00LS 0@ 000000C5D000CS00S PP 30P0TP 20T0 0!(00C(0!S 8" -LM@  -LM@$ -L@pa00000S Y000p00CS00S ;PU(0DP 0000S k808 40PR  00CS00S   "48<#820000S I000808 4R  00CS00S  8" -LP@a00000S 00000CS00S ֱ0pS2S 0 =S2 R mpP|0p㳠0000S 000808 4R  w00CS00S  8" p-L`@ PP P"000@! 1R  0VVV S!00CS00S r\c Q-? 11 0<0`QT VV 00000000&02SV`/00010S(!0 !00>>@@D020!0 0S0%`8.3 000CC "48<#82<00S @P ipp{]pwps\php 8"$(8"$~ 0-P@LT 40S =?000000 -M@0L40pS RH10`S 8100SV VVb "48<(C"Q#8,0 :-? 1;0<0Q q 00000S 00000CS00S 0S<PU90VV00P0,DP aPP(ꌸ$ 8"0S000,0S000HPH U"48<#82 0S 0!00C0!0000S 000808 4R  00CS00S 1   p-LP`@Q0p0SP p0 p -LPD@K M;}?p@p 4K00 D 9A0000S /000808 4R  0`0CS00S ٯ00000S 00000CS00S ï0SX 00 0S2=?0 D  8" -Lp`@<00000S 00000CS0"0S 0S 0 PU00:0S S S P0iP.qP 0iPS(0 PP rP00 `c 0S2 V HP v=?0 0PPS 0S P000000S 000808 4R  00CS00S *0 !Ô3! 000\fPPlP 0 8"(8" -LpM0$0 0$ K @PO (Q00000S  000`00CS00S 0S20000D0@u00CS00S Ԯ0000S  000808 4R  00CS00S  8"$ -L@S \j 0S2 ^ 00S0000 0-LP M @@K@0,P000 p-L@P0`SP p0 (p -L`PpM@PP 00S 0 00 -L`0   V00 P@q00000S 400000CS00S 0S 0S2000 00S S  S j'0 0'00S   0Z0000000S 000808 4R  00CS00S ʭ  8" p-L@PVPU 000 @0 000CS00S FT @>TPU 8" -L@C0PS 0C0  01RI Ap$a000 P 0!800C80!0@0A0B0 00CS00S 0S&0HP" Q R 000bSP Q $ R T000bSW   8"p!<" 0-LPC0@S0C0 0R5 0S20HP Q R 000bS P Q $ R x000bSh@000o 00CS0 0S 0,0S0E00p!<" 8" 0-LP M !^ !ASMK 0S ! !IPP'@T  0R K40 0400  H|!a@TH\=@P= 4P 0!000!0    E 80@ 0 0 ,@B0A D C 0l 00000@00CS00S ^@ 0SS5 8"0 p-LP` !!^ !ASҭK 0S ! !έ۴@T% 0S400CS40 0000000CS00S ע 0S 5~p@Tp|! 8" 0-LP !^ !ASK 0S ! !сۤ_@T f@TD@.@ P 0!00C0!0-@P 0!00C0!m0|! -L@ !^ !AS 0!00C0!U<00`4\ -LpP@`T 0 S `@T 0ST  0S0CS03 0S10S.V00000S# 0H\ P R t000bS\ P $ R D000bS,0S00 0p0 @;p!<" -LPpP @T @T 0QT @1   }0S  0S6 0C0X`  sPX0?S`PU0S0S0S 00,0S0E0.0 R 00 R`PZ , 00CS00S  8"(8" -LP`@pT 0 S `@T 0ST  :@Ph 0V0@@ 00S02 -L R 0S 0\ 0S00 00S00 R -L@ 0 R, 0S 0T 0S 0S0Q R  -LpPM,0 o PU PU 0QUa 81   0S0S 000@`@`,0V0 ZP X  0V0C0,@0!@T# 0R0Z R 0S00,0S0E0.0P 00P 8"sP ( 00CS00S ǟ(8" 0-P LR @S: T 0 0R @I: T000000 -LPM p0S?, 00 _ !^ !ANKP `3 .㒿00` @aT  PP000|!@ThV 00Z0 ,#00 0  ``p0! !"L0 R d0S V  j!|!$ -Lp`M\ 0  PP@ ! KP 0 -Lp`SUF  0R> 0R: R 0S4S@P  00CS0 T" 0!00C0!S0T0  0!00C0!S{ PUb -L`M0O0S"!^ !AdK0 8  4K, 40 0 P< Pb080 PU  PU @T 0 S0 S  <0@@7< 0@@VV@.T PP`0V* ӳPP  0<70Q *1C0! 0Q:0 8 0C0eT 0 0Rh0#80 %\*T  0R& `T0` .3pPh 8 I T 0F`0 0`V*0 0 0`V: ! :@@`P|! !P`0V* mPP 0CQ10!AQ @0 80 0<0PT ! !ѥ00 R d0S 8|!$ -LpM0O0S0Sx1!^ !AbK4K0 , 40 0 PV PPIU 0PU 0S ,0RUC Q! .㋽`Ph8 @ 000 !ᑩ0@ )P ! Ⓗ`@T  09 ! ~|! 0@@*`00T0! !00 R d0S  |!$ -L`  MO,Q Q!^ !AΧK0K0 p( 00 , :P] PpGP 0P 0S (0RPJ 00p! !ѽ0 R d0S W   0 S0!QܬPM?@ 0  003S \ )U  0  003S ᯪ\ |!$! !u,0 R d0S $ -L@`M0Q0SQ!^ !A2K Q 0S 0RQX 00! !0(1 R d0S X0Sp1p!NP/m?` 0  003S  3\ PU@K㐩0 :K 0 003!S  \PU |!$! !ڦ(0 R d0S b$ -L Q  P 0 S0SP QP\ *0S \*0 1SP0\#)P0\: -po 0LS! 0 0PP  p 0!00C0!SG û @T -L\\ 0S\ R Q 0SQ 0S 0R 0S -LM, 00 1p` Wx PU 0!000!j P1HP Q R ,100bSP Q $ R 000bS< 0@`T3 @040@ R0( 00c0 0A0˳` R`00R 0!00C0!Sp!<"@T 0!00C0!S0pW 0i`c00 ,V`V0 -L(M< <@ , 0 4 80 X pW 0!000! Zq X!000`V] @P ,0!0100A0Q ,@ @ PW, < 4 <( "4< ,<0<4<,4.<0 0 <<4 R< 480R x 00CS00S c 0!00C0!S+ ( 8"LPX`d0\h(8"`V 00CS00S ?Z 0!00C0!S0Xq4<8 ,00a cYY 00(8" -L@,0xP P  p-L8`@$PMT@ $P p!p -LP `pRQ R.˩P 0X$ \V ᾩ@PT =?0 0T@!  003S  ǧPΩP  -@00L,00@@T 鰸$$ -LR@`0S0S#B^p ZPE`` @OT0\U  0C0cPP ($ p-L@PPK8 @M⡦00`H@ S" X@K PV0[S T0X`V 0!000!P 0! 00C 0!S9ꬸ$p p-L@P`K8 @MjPH@ ! 0P P l00S PX@K P VP[P 0! 00C 0!Sꬸ$p -Lp`K`@8 P@@M1\P PXp T` L@K\ 82 0RPPS p0S\ `Kbh@K0 P 1`K0 Pd00S`00Sj0PE d080X0 S`0SPP9Q 0! 00C 0!SU8XQP`K <0 `0 P 0`K0 Pd00S00S 0P0`0SPPP 0! 00C 0!SfX  0p!$$P 0! 00C 0!SI -Lt1XM\0CXY:-? 1:0<0PN T@ 0  003SK @KᐥT <1ȠK `K XpK0KhPP(0X0[S00@PT  00[ST0T0@hPT  0 P<P 2  $$ -L R 00CS0@S00  P -Lp`@PMP0S4040\ 40 00ꬸ$$ -Lp`@PMP0S4040\h 40 00 ꬸ$$ -P L0p0C S0  -)`V0`0@TT ؤT@0@00S  P@T@d鬸$$ -L4pKP XM| 嶤x`K4㲤U00@T/ U0D0 0CⰤK80 <0 3K#K 0/0K0 K00.0K|0K-PKx0  0`0 0Z<0l0  D0K ꬸ$$  D0K -LP@M0p 0H`  q@P5t 0@5+  Rr  0@ 0V0S5 @0y0S  0@p  0@i -L@PM0 ` 0 p0  P dI5 @0DP 0 \P0QP0ZP0WPP 0' 0 0P 0,P  P  -L@ P >v -LQ@ Q 0. zP 0S -LQP 0ASD\T\\T@T @T p-@0LSppX`PP 0!00C0!S0PU00Z 00C0|0p<$ -LP 00CS0 R00 R00@ 0P0000 0! 00C 0!S鴸$ -t0L@\ 00X 0S0S0S0 ^\鴸$ -L R 0R  RP R h0RP l P -LPxM `R| 0p 0S$PPt 5c 0!000!00@K8 |00 0 0 w0KTK?0[S0?0KTKd1@K0 P TK@1 0d`P`V Y00`0CS00 0h00XQ 0!000!05c``P 0! 00C 0!S0@+DP%5  0!00C0!S~|ꬸ$$ 0!000!00 0!00C0!So -LpPC `! Pp.h0PP #0p00  0T0 000S0 0 R 0CPڴ00S S 1 000cPڰ0SSQ  㓠 0S 0XS00Q l ㅠ(0S0 0000!R 0S 0S 0S*0S 0S00h0PX @ 0P{@T0S 0SQ  㡩P Pea@T@ T T0R9 0R5 0R1 0R-$$0 ラP'0 0# "T0S# X 0R 0R  0R 0R0 0#0 0\S @T@T 00000000 0! 00 0!0@S0PP0!$$0U0 00 0-LP \,00PPX@ P\ 0\P 0! 00 0!000000;0 00!X - 0 XlL -L@P Mhp 0P, 0 40 `00f0SP x4 d0Q0d0P"㟶0 00CPP00 0,000040 h0S  0C0Sc0 |00 0S h0S0 0CSQ 0jd0S h0S0  0CSA  d0Z$P70S h0S0 0CS, 0ET0Sl0S h0S0  0CS l02h0S h0S0 0CS  h0"00f0d d0bS h0S0d0-D V -L@ Mp 4 0S` 352(S PS `00 <4<("4!000S<4<("4 <  8#8SA(A$A"A!A a  "0 0Y00 10004S0C808003  000C0000C0DQ7 @=?0 0  003S8K @8KᏟT 8`K:)@KןPP@<P U<0 0 P :00@@T ǦPT]001S 0S 3 P00`0YG 3 0S@0S003=S7 +P 1 3@ 000H0(0C03 000 000L003  000 000510 -L@Rpp0` PR$ V 0S U T0S X0S0S00PZT0^0@00 R鴸$ -L4S l 0R0|Q頡! -L@0$M  X 0Xp  P@Dl@ P,`0^(W$ @P`  l  L0 P0S   cT 00 -L P+0@+6 -L Qʙ+0A00c6 -P `LV  V L KP@@DpPF  = !000Pp @*^$ @ a< 4 <( "4,<31#:##5# 2#0 1 Q 0 S 0S 0 S00TP8 00CS00S 4 8"(8" -@L 0*鼸$ -Lp`*PPK ܝV00 0 00C0S@T@* 0 ƝV` 0f #<4<!4"<0 Q0 Q1S h 000 Q00ńP!0000PQ, 00CS00S , 8"(8" -L`pV5  0P a<4<("4%<31#:##5#2# 0A000 0R: 0GP 000000 @T 0U `V -L`P@pX lP ` 0!400C40!SV  @00TR0S00TP@!ԡ! -LpM$0`Su  0(0 $p @l0S `0SW00 $ K(0KP#0Up@T P 0R 0S0 0RWX 0<$ K(0KPP 0! 00C 0!S\p 0! 00 0!0 ԡ!(0SP 0! 00C 0!S@$Q 0! 00 0! (00ԡ! -L$M8 @4 $<0  ZD  qW pPh Q ,K 90,  8< 00KPP 0SR* Z 0 R <4<("4(< a31#:##5#2#0 1@``@T 0XT@  0 0S@` `@O @T 0S 0 `@T 0S0 0RT9 0S60 0R1<0 0   @` `@,0 @T 0S0  0D S8 0R0 Ss `@T 0S0 0Q <0 `@<0 000  ] h1h000 ?(PPU ޛD 800$!000P00CS00S `@0\00& @0000000CS00S K0 4 <0 0 %00C04 <0 꼸$ 8" A0 -ML0 80 $04 Y qW 4 PQ ,K (0,  P<4<("4%< a31#:##5#2#0 1@0Ut@T 0S@`<` T%0d< V <  R 0S R 0S 0S  0S 84  0%P`@T 0S V< 80@0000 0< R 0000000CS00S 0 |00C0000 00m 00S0ڿ 8"$ -0@L T4 0pPS)J 1`P  R 00 0000000CS00S G`PpPUZ00g0@T $ 8" -LMP , 00 U- 0` S4 $ , 0S40pW@T , Z  倀00Y @Tp4 `WPU  -LP,M, `0 V00 \ 0 YUJ 0pW040 E4 W> =0S7 1S4 @ 080 8 X00, @0    0 0 0 0 0 00 007P @T d0S0p0 0pWpd0S`Vd -LpP@M \ G`P?       @P0P@PPx0S 0!x00Cx0!S @@L@0 0!x00x0! 4P0Π% 0  0%$ -LP@`p0 M \4#  0\t 00p 00000 0$ P  0`8 Ġ̌H~$Č%̌6<"@$v -Lp`T3M 0S<4<("4!<C  0 S43 0bKsJ$0@  0 Ġ̌.Č$̌L@ T à#6P2 0PPU"000 l"lŸ000v%@P 0P<4<("4!<0C0 000$00,0$0 2 X4$00  0 S   % P4 * P 4 &4PK8 00  尘X 0S 0 , 0l0K=> @!0 0 K 0 &K06K`KK`K!P $0 0%j0 0000@ S0cRRBP0PSx000P!PDT0P000KU80U !<"v@$ $$!!?0U0Sc_[|0 <R 0 [0 0200 `P /(`0001SA@0A0 $0 P;% $ -LC -LpM 0Rqp0 0P*0, BT` !0P,V 0f<4<("4!!< "\= +0BT`  !P ܥ!V 0f<4<("4!!< "\ 3"0#3"0# ,0, S R00S Q0,0 , R p0h0SX00S pW 0-LP 000@T 0R 0R 0RgP T 0!000!@T, 00CS00S #0 8"(8" -L pPLMt l0 ` 0 @p0 Wh d "P Wp 000 0!000!h0!t0PS|`p @T0t t l 0V `@K8 dKp0 X` T0 '@Pd 0!000!d0@ 0d0PWl lh1p0d000d0@Q 0!000!000D!000t 嶒"0d((d0X0d0hQ 0!40040!hd0p t0t0810x0d0Q 0!000!d0000 20d0000000d0p 00000t Pct 0d  cU pܥ!<"h@W 0S0SP n -L@`$p080Q0Pp 02S% S S elSG 3S/ _S]0d A0CcQd0QbPP03PSG0d A0CcQd0QbPP4 010d A0CcQd0QbPP 00d A0CcQd0QbްPP 0#$(,"(<4<000 0,000 0 0? -2LD0QX0:0 -$0L0$ 0S !! p-L@0 @P!Z[,`\ ` 0S000||0S00|0,0t0(0p0p p-LP@` $ "<4<!4"̃,5,,:#ˠ,ˠ 1 0BR 7S(0U 0T ,0^ 0!000!p 0B1Rp0! -LpPM@<4<,4$l&8&k0&k1 0, ^! 7S0Tt0Y,0Z |0R p0,Qh0SU(0PS @ 01^U 0!000!?P0!0S9 PP6 000 0Z0[0@ 0@h@|00,t, 00p  0!000!d0I 0!000!40001 P0 P v<"0!Ȧ! -L( p-LQ@P`d0  Bd0QQb☯PPp $0 00 p 0Cp -L!pP0K KM0 0 p $$PL  PKW$0  0`P h0Su0S zPPᘠK 81 Pu0 S Ad 0@C 0@ `t0pS $0 0S00 $0  0P 0P 0S @P 0P 0!00C0!Sv0@0 0Sʂb !g! 0 000q0 S 00 S R  0㊭P{\M (b(d@ Bd0QQbͮPP` y0$00 0S 00S 0 <0S0 0 40 $005,@T 0S`` J 0!00C0!0,0׿8 $(bࠒ$0( `/,1 0!00C0!SrpWJ1gA0K 0!00C0!Sb@DpWZx0S 0!x00Cx0!Sᶪ -L@0$ 0@00@ , X0,2c2d c R < 4 <( "4 ,, 0TR8(0 S R2p0 S R,t0P(v 01# P l R R  R |0R 0 00 | `PP P 0t0S000 0pWQ <@DYkZQ 1a!00t0S Q 0!00C0!S E<"̸$ 0!00C0!S 0-LP(L@K"(8MP, 0qP0 -L@P T 0S(( 4 0!00C0!a -LP 0S 0S ,0 p0S h0S  P -@pLP 0!00C0!SI0p0 -L -L@P 0S 0S,, 0!00C0!@b -Lp 0000QU @`T  P00pp`@TPUXl 00CS00S y @0pS0S?P W 8"D$(8" -LP -Lc - La -Lp2`Pc@pP 0   h0S 81S 0S p0X 00CS00S y @TQב0fPcWU 8"(8" -LP 0S`01Sh ,0Sx00,0 0Sh0 00S\000SP000SD00 0S80 00S,000 \$ܹ$La(bbxbXdd -L P 0S`0D0S S  0 ,     \$ -L P 0\$ -L -LQM -L@IP00P P P P 81S 8d 0-LK 0KMl@000`P\  0 0 00CS000S x 8"ئ!P@ 㒝Ȧ!0 -Lq`h<2 R Rh 0 00  0!00lS\Sp0 0  G? @ @P00dSFSpi0S*0 00  0!00lSSp0 0  G? @P 00dSSpX w) 0IW!11!Ѽ0P 0!000! R (0Sph0h0 (0S Xc 0!00C0!S4<"G<"Ȧ! 0-L -PP# ㇅00PP0  0 I?T T$0Q4!0E/@0 0000dh<" -@h0LS \㩩T000H0 @ @ 00CS00S wFt 8"ئ!x$ -@h0LS6 0 h0  0!00C0!(0S  0 0 0!00C0!IP 0!00C0!0S 0!00C0! -<@0L00 00CS00S w 8" -Lpa000P !@*0S&W ,0S! 0!000! 00CS00S ]w 0!00C0!SU000@0TP U< 00CS00S ;w  8"$(8"Ȧ! -LP`pMu@P 0 00u -L +0RUp !pP  8"$W 0g<4<("4!!< "\ 3"0#3"0# ,0, S R00S QT T00S HQ i i0R E? 0 0R!1RH` R@  0C0S8 0@R Ra *0X R Up !PXW 0g<4<("4!!< "\; +0RUp !PW 0g<4<("4!!< "\ 3"0#3"0# ,0, S R00S QX X0a*0\ RUp !ᦊP\W 0g<4<("4!!< "\; +0RUp !ᄊPW 0g<4<("4!!< "\ 3"0#3"0# ,0, S R00S Q \ \00DSD LP`0VH`D VRy@0Sv`Ps 04 800,04 PT1 h <1 `0 ` 0!000!(0S-  8,P P   " " "<4<!4"<#%##*"+"+< < < 0  000 0!000!0 0!000!00I>0,1P0h0 0!00C0!SZ@`D V 0!000! @ RD0S  $$<" 0 ( 00CS00S 0t(8" -L@7S S 0 0",$,!$#,"("+"+ ,!0@000@ 0!000!7,(S S  0  " " "<4<!4"<#%##*"+"+ 0  000 0!000!L0IdP 0!000! ㎘$$<"Ȧ! -<@0L00 00CS00S s 8" -@MLpP`D ` 000`(, PP 0!00C0!SP 8" t|00 p, 0PLl 00CS00S osU  0!00C0!Sc(8" -`LP` r000(, @PP @T 0!00C0!S<@h0S`ᜁ00CS00S %s |T V  0!00C0!S@000h0S*^ \0@i@IdP 0!000!G? 00  00CS00S r 0!00C0!S 8"(8"<" 0-PG? 0L 10@h0S 0 1R  1R 1R 1R0IP 0!000!i0S 1R  1R 1R 1R0<"<" -L@N,0 06 0 aQ 0  -L8#p`PP X@000 ` 00CS00S :r 8" -L` MpwPP l@000000 0 0` 00CS00S re 8" -L 000 l0S 0!000!| 00CS00S q0P  \0 00CS00S q 8"$(8" -X0L00H 00S00000CS000S q 8"$ -LP@(0ST, 7HP 0!00C0!Su(@0`<4<("4$|<4<("4! 0g0V*@ 0gẃ,.L, 7P 0!00C0!Sk`V:(0S= 000, 7(S S  0  " " "<4<!4"<#%##*"k&k`x0  000 0!000!< 00CS00S &q  8"$(8"Ȧ! -L pM, t 000 ` `@W ,0S@0T ` VZ ` Q@ 8"$W ,0SJ ,0 P@0T` V( 00CS00S p (8" -L<4<("4! Qu0aQ0%#0"0%) 0000 -L<4<("4 !̃\ u0 bQ0511030#0l0 10 -L0p M0 S40 , 4, 1'0@R R0 *0R U` ! P V 0f<4<("4!!< "\k +0RU`7  !DžP/0*0R U` !ṅ P V 0f<4<("4!!< "\; +0RU`  !ᗅP V 0f<4<("4!!< "\ 3"0#3"0# ,0, S R00S Q 00S 4000S40 [ -LPpQ0h00i0@`@T  @TW   㒔!Ȧ! -L0p@`@P@T  00P! -Lp`L(@"X@T 0S  \ ! -LXPp@`T 0S  @TV   @!Ȧ! -L@0D SYPMH*m pP B `=?0 0  003S 0,0  2~`T |V' `P0,0 !PU  ,0K00,0S,Q  0!00C0!SJ0,0  , -T 0L00D0000CS00S o 8"! -X0L00 0 0000 00CS00S n 8" -LP 0S`001Sh0 0 $$$ -LP 0S`0(1 R R $ -L P 0$ -L 0-P@LT 0S 0!00C0! 0!00C0!S000 p-L@0PU`0 0!00C0!Sq`0PU 0p$ p-L0P @Pp U`` x nz0P0 0!000!0P00p$ -L3Q@p 2Q )lQ &P`%P`"d0  Bd0QQb PP 0 "48<#8,$, d0  Bd0QQbPP 000 000 -L 40 0 S0  R! -L 40 0 S0  RX! -L 40 0 S0  R! -LpP @P<`RP0 P@T! -LpP @P<`8P0 P@TX! -LpP @P<`P0 P@T! -LP0! -LP0X! -LP0! -L -L 000 Q! -L 000 QX! -Lp` Md BP@ @gTT@<K,@  :#:,Ơ40 1 0 180 0 PU[ p00Z,* D 0X00叞 11 @gT@DD0T@80 00<K00h40 0 ,@ PU2 p D0D 0Z:0P `0Xpt_d0 @gT T@@0 h00PU p` VU 00P" p-L@`("XPt0S U+ UPp 0-LP@0! R 0 0C00@ 000!P x0S 0!x00Cx0!S0 -L 㴡0 @6ඏ`lVp^ Wx0S 0!x00Cx0!SPቐ0&1 0PP00h0S 0d 0S 0d  W0, P$P@7  000|0 @@ ! 00#4000Ly@0!8<400000 !202l$-dH! -L `tp<PPR 0&1 0@@00h0S 创0d 0S 0d  0, @$@`7 ,  000|0 00 ! 00#400W0xw000 8<40000 ᴣl$- -LpX 0@6Վ`PK 0&1 0PP00h0S !0d 0S 0d  ㋎0, P$P@7 ,  000|0 @@ ! 00#4000x@0 8<40000$ Tl$-N! -@0LS 40 0 cR,00,@0S<" -@0LS 80"0R,00j0,@0S0 "(}@l X0}@5 0 80}@ R@ 0RPUp 00CS00S d0h@c T 00h0  8"p$(8" 0-L@P 000P 0S00?00P@P, 00CS00S d0x$ 8"(8" 0-L@PP @ 0 D0008 00 00CS00S md0 8"x$ -L@ "48<#X $(,!48<#8"(cpPW 0vPZ000X00)`("("48<#80 0B0S r000`0V00ڰ!P"48<#U "48<#XX0a00<" -L` "48<#H1#$(,!48<#8"(cp@ W 00v@Y00X#P("("48<#80 0B0S  >bpPUڰ!@"48<#T "48<#HXa<" -LP -L 000 P Q05050S PQP , 00CS00S c 8"x$(8" -LQ 0 P  P00RP  -L@0   00T0^0S (0"(#"48<#Ƞ!\!"48<#\P ^^ 0S0S0, 00CS00S 8c 8"x$(8" -L0   0 P  0R  0R P\ @0 R0 00CS00S c 8"t$|$(8" -L0P0 -L 0 00C0 0|$ -LP@`0pS T1S000嘁P  0Q 0R  0RT100041\ Q "48< #"48<#^!"48<#^  0$4R \ 00CS00S bdQ @P hP 000@03 0004 00CS00S ob  8"t$x$(8" -L@ 000P 0R  0  0R00P@0 00CS00S >bt$ 8"(8" 0-L@P 0000S00@PD 00CS00S b 00S0t$ 8"(8"|$ -L@Q$K -L `PtMM?@ 0  003SHK p`HKRoV 7HKP2 8`K3pU 0CU 0CU X3U L3U 0CU 03U 1:0 <0 R 0Ss&RR 2R  R5@ 1P I[6S0S000SRW 000QpP   050SPa (K0`K000`K0K)K05ᜠK0S6[06KQ  1R ppk]! "48<#X!48<#(0b S8Y @T ("("48<#80I@T 0㷪yW_  #K00aWX 03Kp0p0X1:0 <0 RA 0S\'ND1: 0 <0 6U@|! R" 0SW$ 6S 0S \4000S.Pa'1:0 <0 R0SWb =?0 0  003S HK n\  p-L`T@PTM=?0 0  003SlK |o@lKmT X0U 0U6[SdK (P `P lK p -Lp`M1yP0   0@T# 0 0 48<#80,48 <#800 0.48<#8yP RP 0R@TP 00CS00S 7`0hPc U 00\ 8"x$(8" -L`p<Mx41 PR @ 0  ,$( ,"(xP0   0@T 0#$(,0"(  ,$( , "( xP RP 0R@TX 00CS00S _0hPc U 00|$ 8"t$(8" -L Aq 0 @0  AqR ("("48<# 0-LP ~@P 0 2S S800]0ᙂ050!00锨! 0-P@LT0 0S00x!000 R 0S  00D!00CS00S __\P0! R 0 0C00P 000!P x0S 0!x00Cx0!Sl0SX0S0S 0!(00C(0!S~ W8 0|5x50( E?%50 8"(8"<"X -0 L  00\ 0 0R 0 0R0 0S \ R 00d 00 0S < 00CS00S ^ 8"p$(8" p-L@M P P `Rb 00(K"K $ 0"0K0P!`ĥp 0-PL!0@S R 00S`0P Pb00 000 0P d0 \ 00 RlP0,0 Pa00!00 p-LR`0@P 00C0p0S`p0S0S? x !0S {PpHP @ 00 ?  0 000C 0pdp -L`M@p!PP TPhU00 0Sj?0 2K=>0808 02K0 &0K0*0K02K,0K -L@pMd0 P S< !48<"8c8<0 3[d;#;S1!X h0S0d00  }d0 S0S [!0 S0S6K`Vr0S0(6 Sl8K80 #8c880  8880 rpP ;[<0<S !100< 0+%< 0 #K 060K#[02+6"+00d S1!R h0S0d00  3[#$(,"( 0CS sx0PS 0!x00Cx0!SƁU @q0 S 00 S R  x0PS 0!x00Cx0!S᥁@Ti  0pT a03K04K.0K 020K_PPH p PX0 @0S pG"=*`Q  "P` d0S h0S0d00hh$ ᣄpV 0 p P00!X00X0!\ d0! 00 @@!0S W x0S 0!x00Cx0!S7x -L@(0`0pS>PP d0Sx0S 0!x00Cx0!S0d00 0CS0* (0 00(00 000P0P06;!5c;00<00!48<#800 0z -L08MX0 T Pp`@YY࣢W !0S P೘T 0S0S 0S0S0 0Sj3K08pK0=>00?00V 0S "0 1R 0@0SP\  \0LKL0"8L0 40L0 P\ dL\V 0S  , 0῍@ P0K }@PP7 ! `00 0 0 0 0 V 0S ឍPh0S 彋  d0Q 0d0l! (000 0`0 ;"5c;0 "48<#80 1!00000 00 00 0V 0S  d대h0S 僋  d0Q 0d0 ~T  PP  x0S 0!x00Cx0!S h$0- H0S`0S*\ 0&5#'PP  X V 0S   0p x0S 0!x00Cx0!S5X1Q00SF V 0S 0S  00 00| (01&00 0d0Qh 0ad0S*h00T 0d0Q h 0ad0S*,܊000  &ph$UV 0S ᣌ\ 00HpKD0   0p x0S 0!x00Cx0!S9V 0S    -LP@@p@ M,0K,P 0 嬇P,8 ?0  0 S"48<&8ch [%[U0P 00  ;#; PCU0P 00  0, ,0S X 00 00 00嶠ᴠ000 ‡,P 0-L@D2PT!0CTQ*0CT0CT|* 0CTF 2T5 0T7 @1T=0CT::R1T_0CT3*[1T0CT]*0CTZ 0CT%1TS 0x1TF 0CTB 0TG P1T; 0T8  l0RC>\ \0R Rd0 C6Q05S0  =?0 0  003S h\ 0-? 1:0<0Q ?0@00 i0T 3$SU -L0H!$ - 0L:$ -L@p`P\10  L0iWA 0U>* 0QU: @P7 g00p000 000170l00p0,0t000|0  0 007S 00 0 ,* PP `PWn P 0È0Ō e0!( @ %%  0-L@pP0 d 0 H  0?0 0,(dO0S0 %Px! -L@X00 L P 00P 00C % -L@h00 XÊ 0!00C0!S ( } 00S  %! -L 0-L 0̠ =?0430 R̠( 0R0!-? ?0000083008H3000!0 -L0!-? ??8H3 0000! -L@`M 0PKs  T@SᰀK 0s  ?P@@> -L@pPM 0ᣓ"@0K| ` DW@P  0 P0P`` -L@$0 7R07 0S 0D00D0 -LQ<<<0R8<80  -7L 0D0 0-LPM@$ 0\ p 0ĉ000D0#4p00  p0XTT 安$0 0!000 000D %`0 -L@H00 <Ꮙ:P(0D0  00D A  %h p-@PL00  qU`` 0S0D0p|| d00D`p0S XP YZ u@0D0p u 0  MPD`p %X  L 0-@PL00  540 SD %$0 0! [P4p!7 0 0 =?00S ,0D000D 00 %tT -L@P8`00  0pD0$0 0! 400 ppp40Q080 pp 4d$0 0!PPXΈ00DpU ( PP$ e⾈PDp % p-P`@L|00  l0l0hd0 0H0 P0L 0D07SD00t0&p %4 h8d@x 0-@PLT00 H {08 000D000$ SD 0 %p4 x -L  R0 t  D 0kr nr or hr r(0$ Q0D00 D0x@ 0-@PLl00 ` -0P SD $0 0! R0SD t0 %  -LPp`h Rڜ0S 00  @T0D0kt00 ot nt  t t0D0 07S\0'D0P0D0H0D0 0 4 dч0@D0 %lL@x -LP0@`pP 00) ᳇%01100 ᨇ 0   埇00Dp 7  07L 吇 007 0(000D0 %<h -@P`$0 0!Lq0  j 0 7   `7 08#87 R 0l1D0 000NTK000D08t jP  =PD0S9 50 0  0,$,!$#< S S7 :0S 0 7: 0# B7D: X0D0 , 0 @ 0h00 %xDPTp -L@L00 @0 00D  00 0R %  -L@<00 0 Ɇ0S 00 0D0 0D0 % 0-LP@ 0000\00 0040l<4<("4!<0p<4<("4!<0$< 4 <( "4,<008 p-PM0L8<4<("4!LT q0,$,!$#1h80S 0C8010^ Z-`(h10 p 0`D0d wP<)0,$,!$#LTPXp K0l @0lp 09$l p00l@0 0 $00$080S 0C800 P҅H0D0 %$P|,l4`T廅 00D p -LP@\{`W 00_P V\K0p00\;S x00 lᓅV 0t 0 0S L0 @ 0 \ P8 % 0-@\;LS L PP p000 40R*@ PP @00P \[Q0  0008 -\;LS0\; p-`LdP@UpL00 @0 4030 40R*d00<00pp % -d0LS 0d000 pt00 p^0` aXT@000 00CS00S Qp %8p 8" -LP@1X0p( $0 0!`0SV ,0 0 b"V0,C 1(0RS0C0\   L00 @ l0hl  l00T 8 <" % 0-L@0RP1P! 0 z 0e 0 p-LP0M00@R`1`! 0{0  $,#44<400" 0 0f p 0-L@PM$@  s d0R0C0 & l Z x0$ K# d Q  a0Bz 0 $, 44<00"0 088"0#8 0$ K#0 -LM⸐0 r0@TuWiM0 xb  ,0K}P@ T009d0`CV8P1P·`+ 0 R %88 \ R lB\0SPU X 0 1t@T@nP ,0S h RP000 }DP 0 R  u<" -H+D;LR P; H+0P;00P;L+ -L4KP@  M`l]4P 0@ , 030 $P : 4H[0,@.  PeU@10x00, 0 d00 , H;T0H;<;,$,!$#,RD+P;0P;0ãP;D; H+P+1S D;P+X封@20 <D姁* H;Pcr0 ᛁ4H+0,@-- U@10x00, 0 d00 , H;T0H;P; L+00P;0] @zYc p`+@˖ R lB\0 SpW 0P; 10_ (@_[,@?;(PCtTDK@<@ L0 ",00 0d ,0 0 L04 K{"L;H+0L;H SP; D;QP; 0P;P; 400 X0@#L+ % H"p?; A,00 Q!0a ,0 0 H;0H;,0S00 , ` % -L@M(00 %R  %(00 8  K0 38 x  p-PMELTF `0 0 0 0! 0峀 00S *S()\P#0H D L P;d 000\ P X0R8 00CS0 0S N %$P4 8"(8"DP 0 R  sp 0-@ULU9 Q6 002 0 c?R*0l ?R${\P 000\ P X0RT 00CS00S NDP 0 R  Es08 8"(8" -`@Lh0PSmp <00 T,0,,  p0t0l % -`PpL|10 p0 `A0000SN 0S 0 4  B!<4<!4"<0000h0S 0S' !P" 00j00 l0l@S 8td+>dKl0 @00CS000S M8 00CS00S M %8 8"4 (8" -LpM  00 300 Q jm PBM?@0 圐 0 0 i 3 0 3?K P `V0K<0 0D0 08 @0 4 0 , *0K1P`: iYDK dP  A 0 /0S0 00 3 0P0 0 3?`20 P 1Uhu ou ku u u 20jPeP#10 04 P:00r 40Pn* 10 ` 0~0 2S _kp op+ 2 p000 (!00010j00 00 X0 0tZ 00CS00S M~@ 0tDvh00 \@000 ] 00CS0c0S` L^<"@@ %D8 h 8"4 (8"00 ~ 00000$0 0!@, Tt1Tt !t 010a#t 0R0t0$00j00 % 8"8 4 0h RX<0 ( 00CS00S L(8" -0 000L)8 -<0LS , 000 600 鰪!<"$ p-L@`P00X`@\l0  0 00  \0}p %< -LP@0T`0 p000l lRQ00 l00CS000S L00~Y400 ( }p0`0p@ 8" %` -LQ}/ p -L 0  0 -L`Pp0 V1}. @Ph .:Y!0V,`:4000<40d1  00x;|;>`;d;W 0000,X0  0 0`0@0  0 0H0L0  0 0T0d0  0 0l0t0 `0 RZ-? 0`0p1;0<0@0 Q   0 4&} %8 t  p-LP`@Pp 000U5h;5l;,0%Sp+| 00%X /\\00ńWH05`@< 00CS00S (Kp 8"l (8" -h0L0 80S 000802@0<0S 000<0208 -L@PM10  T0|T 40KcPa|1U' ]?P0Kԁ2n;14p?X03K`FV0K8#8#$(,"("K0 @bt Tԁ(dt|T4 %`\4d 4a -L@P <00 0Y|00 Q| % -LT @0@00LXdx+0R  Co8 -L@dx+0R  2o -L@400 (|T % p-L@ 0R`00pPU `0p0` Pp400 ({d 0 00tPrp % 0-L@0RP1P! 0r0 0 e0 0 0-L@p 000 0S S , Pz 0@H@0@`0@ `0@ 0 \ 0yPUyPS0S @ l Shl l0R  l00@ Dy % <"$ <l!4! -L@(00@ ym00 % -|0L8@0007 00CS00S G 8" p-L`@|00@ 0hh S }y\P0000S `00CS000S Gp % 8" -L@T0   P 0S( 00CS00S G 8"(8" 0-L@PX0   P P0S( 00CS00S qG0 8"(8" -Lt 0 ̪!- -L00p -LP@M20@ 'y|0ty@ R 0@0|0 4b0@ 0xT⥚D0Sk R000||00T7 00CS000S G!00CS00S G|0 `0@ hx]?PX1| 0RHxhp0`K000 ,P o00|0 j``p0@ x0 0 0S 0@ xD`7 <7 |0|H0S! D0S 7\0S o4Ph 4Pe %$t 8"(8"T$x0Xx0@  QxPQ 0-Lh0P0@S T>xz0 P <7x 0|z0T0/0$8 p-LP8a0@ ,x(!0001@TQ! ^  0 0 0@  0\ 0w 00CS00S :F 00CS000S -F PU=?00S Pj00@ wp %\ 8"!(8"| -L@` p~p PP 00@ w0 V00S dSPH00@ Dw@P6m=?00S  % %$ - 0LP i Q$ % -L@ 00@ vw % -LP`p@PN Sp!0X0T0`@PgHph0d h l000?0!<1R@!L1R 70708090 0C:0 00  0U 0!000!0 00800P0@ | $w0L00@ |w707U X "# w 0!000!6 #ت! $ %\48 p-L@a0@ v 1R v00p  0P 0 PP\!0000@ Dv R eNυ0S0000 P 0QP `A2D 00bZS0 `V @'A$A`000[@0T  0 0``0   >e O?`V `000 !$00$090PP00kow\xA00CS00S a3LW000\`V 0 0``00CS00S G300  d0S w글00CS00S 13t0  0 d(@0  \d t00TP  N % 8"<"(8"$Dl 1 0D0 000 00P0 0 00CS00S 2D !48<#Rc  0R00001 0C1x! H1 Dt!0H1P000<" 8" -L@ 00  ld % p-P`LV \d p@T 00p00  ` Md0_,@ktot tpp %X -L`pؑ0  (dHu@P 00 H?P!EpP5005405`800D02S0S8d 0Z0R0S 1,$( ,"(0S@E 000Z  ?00  0000800 080  =(0  0(00( \ 00CS00S 20  , c %<" 8"(8" -Lp`M 0  0P@0 %Ġ Ƞ̌,Ƞ@ cWW c9W@@ (0K_J, P.V T(00&@(0 P, W(0@$P, , K(0+P %Hx0  ,aSc(H, 0-L@8Q0  ,Bc p?PB 005405805000 0 0000 0800C80 0   0 00S00CS000S U1G000CS000S F10  b0 % 8" p-L`@("XMH00  <b02K0$0 %48<#8( K2K+ % p -Lp0`P00!10C1<4<!("4!LT00 HbT801S40 (@ %0! -LP 1P 霫! -LP 01霫! -L@0N0CS0300S 00 vb40 0S!01P p00 hcb400c/,000400D00D000D1D1000 %L` -LNo(pP @PU3C0EI@0,$,!$#, "@\P0E PSMJ A<4<("4!<0<4<("4!<0<4<("4!̃\30E PS0J ^ * <4<("4!<1^ ^:^ 01 0nA0SQ 40c/ @P000 0 000 0040 -L0@l`M40 x00` ,0 ( 0P00   l0Pa "2p | 0?#0 0 00 P pL`P 4K  T %|$ 0|0 00000D0 0-@PL00  t 7a0S0D0 'R 00D  7#$(,0"('! 0|0 00 % -LP`p84M#Hd0   P0@Qa08K3K880 40 (P 0  Ba  %XK T00X0 H0KH` Dp @ CK 0P PP0   $ah 0-L@ MPP o0$<!0 0@P8! 0E0 00 -L p-L@`PM00  00 `@<4<("4!<0@<4<("4!<0@<4<("4!<0 @<4<000c040 %p -0L # -0L # -L0A\1  ^,=< -LAq \0L 000\lCL 0 S0 00 -LAq 0 0Pp 0-LP@ 00#1!@<4<("4!<0 :0 0-LP0 #LT  :00 -L0,$,!$#< S 0-L@P%Q01@<4<,4"<0i:0 0-LP@#C 0 -L`p Ġ̌.Č \URP@@F B:00@ -L@,$, $!,R  -L0 0c  0 0 00 -L@P 00a@ 00 -L`P@V@ pETL_ d90T `FPd9V -Lp`P@\*0l00 00 nTD \ d A*\0S 0@l,6Q ʠ,ʠW 00 c2b217c! b0B!>#p10 00 c2b217c! b0B!61S0 \0l 00T1P@T 0S 0l00 00hpWP" p-LP@`T; 0Qc PE23Q4*Q0S 0@a!6a:#:@U%  R $0S(0S :\ 0 b2b217c! bB! L TJD`PUpP" -LPp@`U *@e  PJ0SG PPdV9 UPf 6*U0S 0`eP%6Z%Z 00U c2b217c! b0B!6 JeV@1  P V@1J#  P0S `V @T   P" -L`PpV00`P&6%6 `PVjJUZHW@1@!T@!`d0Pd 0c2a217caA00 c2b217c! bB! 8pWP" -LP`%6qZ%Z p0JeT@!0 c2b217c! bB! a8P UPp`VP" -L@`$6qJ$JZd l0UP!0 c2b217c! bB! 78@ T@p`VP" -L@P`p0U00 R& R e8U 1 !0b\ #*0lR !R 0   eU f 0bR !7V V0e &U010!  ed0 0e e0  -L -L`M4 , @<00 0 PjDP 0 bD04 PR#* 04 AT  pSD0PW *p00 FD0PW: 00P4 0 R4 :Y,0`00Pi 00 ,U0 004HXd0 -LM4 , @D00 0 P DP  @00P@C 04 PR!*04 AT `V  0pCp $`C0PW: 00P4  0 R4 :Y,000Pi 00 ,U0 004hXd0 0-P0L@@<00  0\(0 kP04P800 %|L! - 0L⢉L! 0-P0L@<00  0\(0 GP04P800 %|L! - 0L~L! 0-@00L  0a\,P@T P$@0 %L! -800L  (I\$ 0S S %L! p-0`PLU @r 0S$Pp %,! -@LP r00 % -L @`M  ^  Q00P^W ? 0  003SW0 SH10  PUUd U* 0  003S<K  9U <K7<0K  <0[00C S PE1000C 0 B R0S 0 0 >U ` PU 00 00S%#}?p 0  003S "ꏮ! ?T% /`P d? /  00@0s@P` P` ꌮ!!0 /P q `PP`@00@P`X0`0pK0 P0K  0@TP00 pl"000@ K0@X@0S0 @@K P0K  @PU# lp0/H0QD@@PK0R0P@K0 @PK@PPK0s@ @PKPPK 0@PK0@0 K8@4P73K0pl!000@ K0@0R0QZ?P@@K0 PPK 0 0 @ @Q# l@pPH0/ QD@@PK0R0P@K0 @PK@PPK0s@ @PKPPK 0@P K0@0PK 873K0_0S@@T@Q 8PU 0Q % 0Q 00\#0ISP3Y ;0 s0s  RQ0 0 P@K @G(0KBK -L45 S  Q R /QM0 %0@0 K@aT,0p;0 0K,K ?T  ,`P00K d? ,  00@0s@P` P`0 ,P q `PP`@00@P``00K0* p-LDE;Po UJP# V 0T0U0S pp~UPH 000p5D030b4 000Vap % -LO ;0S M< 80 P 4@K-$/ O<00@$SP0@ 8K< K 800C80 0@o<0@ᣁ~80P=O*P` p-L$%;0SPo$M4 00 R ,@K 0K9+P 0K7772K,0KSR  0K 72K,0K0K4 K4 D0 K4 0 ,0K-'"Kp -L;P P 45S ~P&ʌ0 1!0Q00/ Q Q ~P45S RR0`p 0 AS0 S S?S S  P  000錮! % -L`;P;pg\CM(@ $ UTF cXWL2$0 \$K$ 0 \0l03002<0R006"W P C84U2(0 lQ(K( 0 Q0 300210R00U@  U  1 A(0$ 2 (0 AB p-L`@;$%;Pe\#M C^ d%`^PRT:P*:(1PRU R K&F^10 lPK 0 P0 300200R00 01 0 `& 0K  B%^P !UL1 0 \ K 0 \0l03002<ꌮ!0R00010 0K  CAp -L/R u -L/R i -LP;@pW;/?"M, (@ 4 0 P0^0\0S PW \^ FMp}GCTP (K, K00S4P40K4 K( 00 @ < <0, 0C%80 40#, 5440 s *`P )  00@0s@P`  0 Q<0U0CR80 U8  -L@;PU;/?p"M0 ,P ( $ ^ Q\P J\P C\P P93$K( K,0S0P(,K0 Ky, $0c}0 (0%5dV#0 (` ~000 0 0P@a+?,RS  b -LP;0S$M00 ; ?4 , ( @0 \0P0R0S iRP) bRP(K, K 00S4P 0K4 K0 (0cY40, 5%40 , -Y44 ,0 y040 , 40RPPU0b40 Y4@0P* i0R,04 #1,0 I 1c40 [40"!, #140 UR0b40 0@4@@I80 40Y<@ @p!@PK00 0r`PVU   ,0`P@>IC0psY@@PK00 0O`PVU@ i(P,@ IC,@ (c4 4 ,0P0cS40 0S 4 400c40 (@04 # -L ;0\M$ 0 P KQH Q B >S0P9 K$ KF 0$ %$0C0~p$ 0 S"\ 0$000@ <`P$ PU`V L  O0 0@P`VP  -L;0S@45S;0S45S  c P 00  -L;0S45S;0S45S C?S S00  P *S S   -L;0S45S;0S45S ?S S 00   P *S S   -L;0S45S;0S45S  P 00  -L;0S@45S;0S45S HD ?S S00  P *S S   -L;0S@45S;0S45S   ?S S 00   P *S S   -L!:@ʠʠP`?P`0K M`0,K,K  R \ R0\00 00 KP``BNl @T<00K?T  '`P d? &  00@0s@P` P`0 'P q `PP`@00@P``00K0M -L!:**?0Cb@0X@PM 0R00@  !4X @00RS 000/|` `p&P@Y00dS(0 YY $ Y000 % _&PQ  000( % -L!:@**RP`00KP`M`0P`00K`BNb @T<,K00K?T Q&`P d? *&  00@0s@P` P`0 W&P q `PP`@00@P``00K -L!:**?0Cb@0X@PM 0R00@  !4X @00RS 000/|` `p%P@Y00dS(0 YY $ Y000 % %PQ  000( % -L`P&:@ペᩚp pY@ K(MH ?0D0 @ K 0S 8@K (,D0' %`P* d%  00@0s@P` P`H `@ RY!IID : -L`P&:@ʠʠ  0K  0 @0p`K  0X W`K@0  KpKKT K0K`\K0w@PU`X`(W&@0P`` pK@0`p0 K\0K`T KVU@0p0S@0p KppK\`KA0@P Pq`0@   pKp  -L@pKLMPpKPK@p  ' _ `pK  Hp < ':p 0K`pK4K P <08 XP S, K 0S 4 0Q 00 @0KPpK Q 4K0S @KPpK @KQ 4K 0S8 K 0<0S ,K 0S,0K 0pK< K0K}_` J54K<K @Y0@* y@ K0pK p (0,K\ R4 ,0Rp 0 K0K0S@@IY%4PK0 K0 cpXW0  00 p#$!7H$B$>I0K0s@Y@Y54K ` 00K0 8pX W @ i`p#!_$a`0Kp I7H$F$0P@0K 00K0K!?"A4K!?"Ap40K0K0 K`P\0S0 0S pW 0K`\ 0SP 0pK0s@0K8Xp ' -L!:@ʠʠ? _`|"P`^0 K`M0 `  ,pK0S 0 9R7 R 0O00 f+\ ,K0S,0K! 0 Kr0K0pK0m_`!@N0@ʠT k8PK0K84 O0 ?  b 0pK @00 fJo0@ 0@`pWV40S80S0 0pK 0K`4p%O1 80`Kq!@KHK @0pP`TX t S`K@0   `K  0 @0p`K  0X W`pK@0 ` K tp `pKX0KtppK`s `KPU`TPK`=S;@0P`5 8K0@BHPK0 K? \@0KpPKp K0@pK ` pKtpXpP`x`Q| RpP``0SP0KpK0@080KP@ 8K `P?   00@0s@P` P`0 T`g p-L!JJJ`P T00@0 &::: S00@0  pPQ   O00 p -Lp(JJJ`PT00@0 &:::S 00@0  ?0Q Q  O00 WX VUQQ  -Lp(JJJ`PT00@0 &:::S 00@0  ?0Q Q   O00WX VUQQ  -Lp`'JJJ T00@0 !::: S h00@0 CVW `p O00  -Lp(JJJ$`PTE?0@0 &:::S00@0   ?0Q Q  O00 WX VUQQ  -Lp(JJJ `PT>0@0 &:::S00@0   ?0Q Q   O00WX VUQQ  -L00K M@3[T㣗ʼ0R% O00?T P00RS 000)p `PY00eS@0 Y Y  Y000 % }PQ  000@ % -L0K@M<0KXK` [l0匘ᩘ#[Y'\ T X O00 P@Km@Q0\+` ! \`P 6  00@0s@P` P``0Y`XK 0S II\X   -L0K4M<0K[0匘ᩘ#[Y'T  O0P P@K@{5 O00@* P@?   `P00@0s@P` P`p00YSII T0 > -L,PKXMDK4[h2hVڴ2V80KO00 h2V_V 80KO00 0"000PK2 5[Rw R :R& 71V4/, o7 #775K\0KW c \0K)%K@0 \0KuKW P@0 95K\0KxJ_`` $15K\0Kp 75K\0Kh)f> -0 p`K 0`K 08K\``Klh ?@4K` @00@0p@K  \ \0K5[\7 S =@? %!?S 4 K``K`0@  @``K`0@ K 0 3[L03K4 (0R $0R 000 % -L0KtMd Yt P@`0K0LTPP X0R Q|P X0Sw200l@S0074Kh2tPUT X O00pt 0!74Kl0Y`@fT`PK?xP `pB ?T  p 5@Tp/ T? p @00@ q pp0 P q p@00@px 0`KP K0w@X0K`PU`Xh K`W@0P``p@t@$p@ H0YP/ ll`!t`K| P`FV0f?00 0pB ?V ʀ ip 5@Vp/ V? xp R@00@ q pp0 P q p@00@p|0@P0K`X0K`Kw PU`Xh K`W@0P`` h0K```0K 0lp  0}lꍮ! 0-L @K(MP,0K[2[Ǡ\ $ [0 0-L @K(MP,0K[2[Ǡ\ A 0 -L0pKMt H`K0C|0 T (0@KK@0p`@K  0W V@0 K @ 0@0Sh0S@ |A|    P@? 0@P0h0Kp0K 0tx |0.tꍮ! -L0pKM H`KPRP X P0R@T`?  p   @PPK∐KP ]`Kp``K0 @ tPK $K p K pP`QhK0SK,0  0 @K  0 @0K`pP`X` WPK@0 `K K0` @K K0S@ PU`Xx K` 0W@0pK`@0P``x K0K`T`S@0P``0SXK 舐K0 0K@P0/RQp0`` K @ .@K ~  KpP`Q P K0 0K0@@0pPK0@XWK@0`pK0KPK`psPU`T`S@0P``0K`@0P`` P K`PpVU@00S`P0KKP`0@000@0s@P`0KPK00pK 0ꍮ! -L0pKM| H0K` p0+됀K >L "P@K <@P0PXʄ@Q X K@ PPK`KP pKQP0K @@@d @ PK` 0PKp@KpK 0`Ph@K@ pR 0  Q K0P`P`0K P`@0p@K  0X W@0P`K`  @K K Q  KQ  T S@0PK`  ^  n?  'P@0"K @K`p K`K00K`pW Q V0UP@Q h0KPKpK`RQ UVP X`W  \p0KpX Kh0Kh0Kp KPK0K` ppW xKP0S@T@0TSPQRPP`0VQ0 PQR 0W@X00 `K`@00@S x0KP KK  " P0K00`K| `\0`pP03| -L0KM HK0@`?T  9p S?` KP0K@`K` `P`@0P`KV`0 ࣰ@K ``PK PK0`K `P> "P`PK0` RK`sSdKlK @0P` TS0pp@0`P@K  0V U@0p`K``PK` K@K ` K 0S@PU`RtK`0Q@0P``03K`@0P``   lPK K? d0K0@t K0K `P`X`WP``0SK? t0K 0m ? g P@ PK0 0 0`K0/R QPK00@s 0@@00@K \0`,@K .~ l K|0K 0 pP`Q P K3>   @K  0 @0K`pP`X` WPK@0  K @ 0KPP@  K P@? @P 1`K$ 0w@PU`X`W@0P`` RK0` sSK @0P` TS>pp@0`P@K  0V U@0pPK```\K0q@Q`Ka `K`R$a@0Q`PPU`TSK @/RQ@0pK@<$!PUo` 0pWÏ1A0o@0K` P``  > p K 8 P@0KY?`` O @PK I K|0K0l0K 0@nK0K0K00 K0  p`Q P UT>K ` P`,B<OTS@0P`1$ 0PoK`0Sp K0KKK p K`0@0@000@0s@`pP`P`` KPK 0008ꍮ! Mp-L$PK|(Function entered at [<%p>] from [<%p>] r%d = %08X%c Backtrace aborted due to bad frame pointer <%p> vK:@K: 02 !! "! !-@ Ѝ1 0A$ 0A 0 04 0A$0A @-Q:  0-8@    8@    L<0 0A   B 4 B0 42   B 4  B0 44 00 -LR:0, 0000L<   @P000 @@0  @ 8@$D@$D@@004 0@\2 f$D L%T\&dl't|0000(DL<   P`L%T\000&D PL@0%D   8@$D@$D$H0 H%XX&hh'xx0000(HL<   P`H%XX000&H PH@0%H   8@$D@ @$L0 D%\T&ld'|t0000(LL<   P`D%\T000&L PD@0%L ` Z 8@@@<$DS  B 4 B0 42   B 4  B0 47 03 -LR:0/ @P`p0000L<   @P000 @@0  @ 8@$D@$D@@004 0@\5 l$D P`pL%T\&dl't|0000(DL<   P`L%T\000&D PL@0%D   8@$D@$D$H0 P`pH%XX&hh'xx0000(HL<   P`H%XX000&H PH@0%H   8@$D@ @$L0 P`pD%\T&ld'|t0000(LL<   P`D%\T000&L PD@0%L W Q 8@@@<$DJ 02 !! ! !@-@ PPPPPPP RPP  0  + ,0 "&P* 103  R: 10#3<    20 1@  RJ03@ -LQ: R$. R R Rrxx B 88 R  R0000 B  R0@ѤP0@Pl\0@ѤP0@P R p\2 R B'4<$DL%T\&dlx R '4p R<0A R B'88$HH%XX&hhx R '8p R80A R B'<4$LD%\T&ldx R '<p R40A R#, R  R1 Rrx1x  B 818 B  R01010 0  B  R0q@qPq0`@`P`\0q@qPq0`@`P` R 0\2 R Btx1&|d%lT$\D#L  R Ġ01 R#̌  R Bxx1&xh%hX$XH#H  R Ƞ01 R#Ȍ  R B|x1&tl%d\$TL#D  R ̠01 R#Č  RS 00R-@ R P P P P  P P P QS    0Q-@Q P P P P  P P P      02 !! ! ! R0TJ03A A 03 Q@ 222@0 20@20 ! #" !0 ! # !0 ! # !l\000Ѥ000 B@-R,, RBJ00ʠl,ʰ R B \xxxx \Z|xx00 < \000Ѥ000p\h3  RB&J'4p<0ʠl,ʰ R B\ '4<$DL%T\&dlx\Z'4<$DL'4p<0 '4< \0#40#40 RB&J'8p80ʠl,ʰ R B\ '88$HH%XX&hhx\Z'88$HH'8p80 '8< \0#4000Đ RB&J'<p40ʠl,ʰ R B\ '<4$LD%\T&ldx\Z'<4$LD'<p40 '<`V*VV#3@"6100 0s@0 f080 ; @@4  la8\2<!< 4 &8L0 1L0P0 =@LP p(8HT*pG@*TpG2@0@bL(PLP h10XU*@P*U@2P0xb8p &Ƞ$1 T 0X0 @TpX 4!8HT*pG@*TpG2@0@bTPT0X 40 XU*@P*U@2P0HPb4P Q4 @02W @8 R W*WDW#3\ 7100 0s@0 40XS:@S4 @@ 8 Rm 4iD@0@4  0c<0 63|<l8Q21,4 '8\0 t1\0`0 @\i` d (8HT*A@d *TA2@0d 5@b\zP\P` 00XU*@P*U@2P0d0bH$&Ƞ( 8  Ȍ""Ȭ\400S^@D ^080 Q 40 S @<2< 8800K0@ ,0  -LMl -LK Md0KQ 0 P:QQ1121:QQ1101:P@  !P@ !!P!@ #!!P@ !!P#2!-[Q 0P1QQ1121:QQ1101: P@ P@ !!P!@ c!!P@ !!P#2!"l! 0 QaB P`BP:QQ1121:QQ1101:P@  !P@ !!P!@ #!!P@ !!P#2!\`B0QaB -P`BP":QQ1121:QQ1101: P@ P@ !!P!@ c!!P@ !!P#2!" l!\`B0@-@P!PU ZP0 0T P!@D  c0^ 0l\\000Х000 R2p@- R J0@4@8@<@PDPHPLP`T`X`\` d h lx RZp 0@4@8@<@PDPHPL 0@4@8@<0 pR000Х000pl\\000Ѥ000 R2p@- R Jx0#40#40#40@$D@$D@$D@P%TP%TP%TP`&d`&d`&d` RZp 0#40#40#40@$D@$D@$D@ 00#40#40#40 pR000Ѥ000p insw: bad buffer alignment (0x%p, lr=0x%08lX) 00 R20@- RJ0@8@PHP XȌ8 RZ0 0@8@ H 0 80000 outsw: bad buffer alignment (0x%p, lr=0x%08lX) 00 R20@- RJ80#80@$H@P%XP,Ƞ RZ0 0#80,Ƞ 00#80000200 R\ ʲ,Ƞ R0Ȍ#Ƞ,Ġ,Ƞ R0Č#̠,Ġ R0̌#Ġ,Ƞ200 R\0 #Ƞ0Ȍ R#̠0Č R#Ġ0̌ R -L@R P \ P < 0  00 00 P^l鏮! -L 00 -LR 0 \  - 0LS 0S00 -LR 0S 0S00  R  -L 00c̰0R @  -LR  R 0 0c<\ @  -L0 S 0S` -L Aq 0S Aq 0Sb -L R 0S R 0 R 0S0S  R -0LS  R 0S  R0S 0-L@PPh0@T 0 R<0 0  P 0S000 0 % 0-LP@T  P00 0 -L Br  B0r0 -L0R \ 00R  -LR 0S  R -LPpI`P E@T @D P PT 0-L@RP0 0S 0NxSx 00D0S X0 00B 0B007C\* 0$D0SU0鏮! -0L-S ` -LpRM, 0 0S 0JxS\ 00D0S< 0D0S 0 P`00L 0L070Cꏮ!70LV U 5F$ H$D ppR,0S -0L-S p -L<@00  001 00B鏮! -LP@h"h2XMp `p @ 0|  0B"S0 0 x0 t  U-0@tP+ pGx  0pGx0   0SpG  RpG000l0K   #P@0|0 l0K  Y pj p V 00ƕ`0pGSx0S p V0ƕ`0S  Rp0V00  R p0V000ƕp `V| !00`p0Vt  ƕ`0pGSp0V000ƕ` 0JYp Vl0K 0ӗ0ƕ` 0ISDlp0V 00ƕ`0pGS -LQ M4 , 0 xS0S l+000p400C80 80GQ0380 5010240 50S| %R 8W7,0 , 0 0CSꨨ lR0 ,K*Q0,0 Xh, 0.S,  0 ,K*R0,0 \,0lShS LS ZS zS  lP, 0lSL0,0 ,00 %0CSS괬Ь ܬܬ|ȬP(Ԭ ꐯ!!8W 00ǕpHX8 0YW0ǕpHX80W 00ǕpHXʔ Pt2 UP1 8W 00Ǖp0HPP 80W0Օ0ǕpP R0HPr8W 00Ǖp0HPhx8 0 0[lP zPZP0 0a0T 0 0`0O8W%00Ǖ@8 W%00Ǖ,0 pR 80W Ǖp50C,0 2LP`& lP zPZP0P` hPPY`8CXo0P` 00@0s@ 0@0O`PP`80  p,0 , 0S8W004Q8 0000c -- L 0G -L0 > --L  -L`@M$ 0pS 0S $ 00  0 $0 00 000 $%QQ 0 $ 0QldQi 0$0  *R$ß0$0 0 R 0 MRK  0 GRDR00 $K$ 0lShS LS ZS zS$ $ 0 S/ 0 S, 0%0C$ SS񟗊꘲ȱl|p @0P00Spp00  00    R 00 @pp00 0h0   0%S 0ꏮ!00 -Q00Q R0D0S R10 R107Q#10#00StR|10n L0N.SQxд$\д\ (K@'(K@w!\ (K@\ (K@(K@ \ (K@ꏮ!(K@T(pP @$00S 0St --L \ p-LP@`T 0Sp \ T 0,Sp00p -LpP`@M U KP @PP0E0  0-LP >0G0C&S7ܶ                             ܶ    % K5% K5% K5000 p-L`P4 00p(@PA  00`PpD! -L 0S0 0 0S0 0P   -L 0S 000S0 0P  -L`@p6P T R Q 0S0@`000C0R Q`000 0S0@`000C0@T 0S 00 0-L@Pk \1 \00u Q 0S0S4 0S1 0S 0SQ0000r 0000P0O> ^00[ Q 0S 0S 0S00@Q 0S Q0000# 0000 P00P 0S0PP000 p-L PR/ 0S+ @ 0SB@^Q 0S  0 00000 0R 0\ 0S   00S ^BQ 0S  V 8p -Lu -L000    -LQM 0R00 M?@00@ 0C0 0!l20l2!0 K 0  {000S00 -L Q 0R 00  -0LSM 0R00 M?@00@ 0 0!l20l2!0 K 0  A000S00 -L0S 0R00 -0L0CS00Q\00 0 0@ 0!l20Cl2!S -LP000pSP= 00 00 0 0@ 0!l20Cl2!S$` 0 0000@0 0!l20Cl2!S0`S  0000 S 0U 0X 0[ 0c 0f 0i @k   " # ' ( ) * + , - . / 0 1 2 3 4 5 6 07 T 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0  P| P} 0 0 P6 0 < 0R00  0 000*01000000700000000 0G 0 0   4 6 `@ P@ @ 0m m 0 ~ @ @     0( 0( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 0( ) ) ) )  ) ) ) ) ) ) 0!) 0") 0#) ,) 0=) H) 0Y) 0QR 0}` 0 ` 0 0  0  0  0  0  0 0㑖 㸖 0Ж 0 Ζ 0K 0J 0N 0N     ' ( P׬ P۬    0 " 0" ' 0' 0* 0) 0@ @ @ A 0 A 0A A 0 LA 0 WA 0VA 0 `A 0 iA 0hA 0 sA Q 0 㦶 p @P@ 200   @@Q*nr_sectors is %d initTERM=linuxHOME=/Calibrating delay loop... %lu.%02lu BogoMIPS init=Kernel command line: %s <2>initrd overwritten (0x%08lx < 0x%08lx) - disabling it. POSIX conformance testing by UNIFIX unshare/dev/consoleWarning: unable to open an initial console. /sbin/init/etc/init/bin/init/bin/shNo init found. Try passing init= option to kernel.Linux version 2.4.27-netwinder (vince@gerald) (gcc version 2.95.3 20010315 (release)) #1 Tue Nov 1 20:02:36 GMT 2005 nr_sectors is %d unknownnbmtdblockftldftlcftlbftlanftldnftlcnftlbnftlard/c0d1p8rd/c0d1p7rd/c0d1p6rd/c0d1p5rd/c0d1p4rd/c0d1p3rd/c0d1p2rd/c0d1p1rd/c0d1prd/c0d0p8rd/c0d0p7rd/c0d0p6rd/c0d0p5rd/c0d0p4rd/c0d0p3rd/c0d0p2rd/c0d0p1rd/c0d0pataraid/d15pataraid/d14pataraid/d13pataraid/d12pataraid/d11pataraid/d10pataraid/d9pataraid/d8pataraid/d7pataraid/d6pataraid/d5pataraid/d4pataraid/d3pataraid/d2pataraid/d1pataraid/d0pcciss/c7d0pcciss/c6d0pcciss/c5d0pcciss/c4d0pcciss/c3d0pcciss/c2d0pcciss/c1d0pcciss/c0d15pcciss/c0d14pcciss/c0d13pcciss/c0d12pcciss/c0d11pcciss/c0d10pcciss/c0d9pcciss/c0d8pcciss/c0d7pcciss/c0d6pcciss/c0d5pcciss/c0d4pcciss/c0d3pcciss/c0d2pcciss/c0d1pcciss/c0d0pida/c7d0pida/c6d0pida/c5d0pida/c4d0pida/c3d0pida/c2d0pida/c1d0pida/c0d15pida/c0d14pida/c0d13pida/c0d12pida/c0d11pida/c0d10pida/c0d9pida/c0d8pida/c0d7pida/c0d6pida/c0d5pida/c0d4pida/c0d3pida/c0d2pida/c0d1pida/c0d0pjsfdddvapblockpfpcdpddpdcpdbpdaedbedasbpcdgscdcm206cdaztcdsonycdcdu535mcdscdramxdbxdamdfdadeaddadcadbadasdpsdosdnsdmsdlsdksdjsdisdhsdgsdfsdesddsdcsdbsdahdthdshdrhdqhdphdohdnhdmhdlhdkhdjhdihdhhdghdfhdehddhdcloophdbhdanfs/dev//rootVFS: Cannot open root device "%s" or %s Please append a correct "root=" boot option VFS: Unable to mount root fs on %sVFS: Mounted root (%s filesystem)%s. readonly/dev/root<5>VFS: Insert %s and press ENTER /dev/console<5>RAMDISK: Compressed image found at block %d <5>RAMDISK: romfs filesystem found at block %d <5>RAMDISK: cramfs filesystem found at block %d <5>RAMDISK: Minix filesystem found at block %d <5>RAMDISK: ext2 filesystem found at block %d <5>RAMDISK: Couldn't find valid RAM disk image starting at %d. |/-\/dev/ramRAMDISK: image too big! (%d/%lu blocks) <3>RAMDISK: could not allocate buffer /dev/initrd<3>RAMDISK: could not determine device size <5>RAMDISK: Loading %d blocks [%lu disk%s] into ram disk... sdone disk #%lu. Error closing the disk. disk #%dError opening disk. Loading disk #%lu... %cdone. root floppy disk to be loaded into RAM disk%s/host%d/bus%d/target%d/lun%d%s/host%d/bus%d/target%d/lun%d/part%s%s/host%d/bus%d/target%d/lun%d/disc/dev/%ssd/../scsisr/ide/hd/..ide/cd/linuxrc/dev/root.old/old/./linuxrc/old/dev<5>Trying to move old root to /initrd ... /root/initrdokay failed <5>Unmounting old root <5>Trying to free ramdisk memory ... /devdevfs      #+3;CScscc !1Aa  0@` ??  incomplete literal tree incomplete distance tree  bad gzip magic numbersinternal error, invalid methodInput is encrypted Multi part input Input has invalid flags invalid compressed format (err=1)invalid compressed format (err=2)out of memoryinvalid compressed format (other)crc errorlength errorRAMDISK: ran out of compressed data <3>RAMDISK: incomplete write (%d != %d), only wrote %ld <3>%s<3>RAMDISK: Couldn't allocate gzip buffer <3>RAMDISK: Couldn't allocate gzip window <4>Warning: bad configuration page, trying to continue <7>Converting old-style param struct to taglist <4>Warning: bad NeTTrom parameters detected, using defaults %2d: %14s %s <3>dma: trying to allocate DMA%d <3>dma%d: freeing active DMA <3>dma%d: trying to free free DMA <3>dma: trying to free DMA%d <3>dma%d: altering DMA SG while DMA active <3>dma%d: altering DMA address while DMA active <3>dma%d: altering DMA count while DMA active <3>dma%d: altering DMA mode while DMA active <3>dma%d: trying to enable free DMA <3>dma%d: trying to disable free DMA <3>dma%d: trying to set_dma_page enable_irq(%u) unbalanced from %p %3d: %10u %s, %sErr: %10lu <3>IRQ LOCK: IRQ%d is locking the system, disabled <3>IRQ: spurious interrupt %d <3>Trying to free IRQ%d Reboot failed -- System halted pc : [<%08lx>] lr : [<%08lx>] %s sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%ckerneluser IRQs o%s FIQs o%s Mode %s%s Segment %s nffControl: %04X Table: %08X DAC: %08X f%d(%c): %08lx %08lx %08lx%cFPSR: %08lx FPCR: %08lx <3>ptrace: too many breakpoints <3>%s:%d: corrupted Thumb breakpoint at 0x%08lx (0x%04x) <3>%s:%d: corrupted ARM breakpoint at 0x%08lx (0x%08x) <4>ptrace: can't handle thumb mode ptrace_cancel_bpt: bogus nsaved: %d! nr_sectors is %d Kernel dataKernel codeVideo RAMreservedCPU configuration botched (ID %08x), unable to continue. CPU: %s revision %d %s%cArchitecture configuration botched (nr %d), unable to continue. Machine: %s mem=initrd=System RAM<4>Ignoring memory bank 0x%08x size %dKB <4>Ignoring unrecognised tag 0x%08x sedspvfpfpafastmult26bitthumbhalfswpProcessor : %s rev %d (%s) BogoMIPS : %lu.%02lu Features : %s Hardware : %s Revision : %04x Serial : %08x%08x ww'߭'timer<4>RTC: *** warning: CMOS battery bad SYS_32UK14_32UK13_32UK12_32UND_32UK10_32UK9_32UK8_32ABT_32UK6_32UK5_32UK4_32SVC_32IRQ_32FIQ_32USER_32UK15_26UK14_26UK13_26UK12_26UK11_26UK10_26UK9_26UK8_26UK7_26UK6_26UK5_26UK4_26SVC_26IRQ_26FIQ_26USER_26interruptaddress exceptiondata abortprefetch abort%s(0x%08lx to 0x%08lx) %04lx: %08x Code: (%0*x) %0*x bad PC value.Stack: no frame pointerinvalid frame pointerframe pointer underflowBacktrace: %s Internal error: %s: %x CPU: %d Process %s (pid: %d, stack limit = 0x%p) Oops - undefined instructionHmm. Unexpected FIQ received, but trying to continue You may have a hardware problem... <2>Bad mode in %s handler detected: mode %s <2>Vectors: <2>Stubs: Oopsbad modebranch through zeroxchg: bad data size: pc 0x%p, ptr 0x%p, size %d unknown data abort code<2>kernel BUG at %s:%d!<2> - extra data = %p%s called, but not implemented%s:%d: bad pte %08lx. %s:%d: bad pmd %08lx. %s:%d: bad pgd %08lx. Division by zero in kernel. Oops failed to kill thread<7>Relocating machine vectors to 0x%08lx portshiftportbasemembaseisabusISAdma high pagedma2dma low pagedma1cascade(%02x:%02x.%d: %04X) PCI: Assigning %3s %08lx to %s IOMEM<3>PCI: Error while updating region %s/%d (%08x != %08x) PCI: Assigning IRQ %02d to %s <6>PCI: bus%d: Fast back to back transfers %sabled endisPCI: unable to allocate root data!debug<3>PCI: Device %s not available because of resource collisions PCI: enabling device %s (%04x -> %04x) <7>PCI: master abort: <7>PCI: target abort: <7>PCI: system error received: <7>PCI: discard timer expired <7>PCI: data parity error detected: <7>PCI: parity error detected: Footbridge non-prefetchFootbridge prefetch<6>PCI: DC21285 footbridge, revision %02lX, in %s mode central functionaddinFootbridgePCI: this kernel is compiled for central function mode onlyPCI abortDiscard timerPCI data parityPCI system errorPCI parity errornr_sectors is %d Mem-info: Free swap: %6dkB %d pages of RAM %d free pages %d reserved pages %d slab pages %d pages shared %d pages swap cached %ld page tables cached <3>initrd (0x%08lx - 0x%08lx) extends beyond physical memory - disabling initrd <6>Freeing %s memory: %dK <6>Memory: %ldMB = %luMB total <5>Memory: %luKB available (%dK code, %dK data, %dK init) initinitrd<1>pgd = %p <1>[%08lx] *pgd=(faulted)%08lx(bad), *pmd = , *pte = , *ppte = %08lx <1>Unable to handle kernel %s at virtual address %08lx NULL pointer dereferencepaging requestOopsVM: killing process %s page permission faultsection permission faultexternal abort on translationpage domain faultsection domain faultexternal abort on non-linefetchpage translation faultsection translation faultexternal abort on linefetchterminal exceptionalignment exceptionvector exception<1>Unhandled fault: %s (0x%03x) at 0x%08lx Oopsfault-armv.c<6>CPU: Testing write buffer: enabling work-aroundunable to map memory unable to grab page FAIL - %s pass remap_area_pte: page already exists mm-armv.c<4>Security risk: creating user accessible mapping for 0x%08lx at 0x%08lx <4>MM: not creating mapping for 0x%08lx at 0x%08lx in user region pte-cachesignal+warnsignalfixup+warnfixupwarnignoredUser: %lu System: %lu Skipped: %lu Half: %lu Word: %lu Multi: %lu User faults: %i (%s) <3>Alignment trap: not handling swp instruction <3>LDMSTM: PC = %08lx, instr = %08lx, addr = %08lx, eaddr = %08lx <3>Alignment trap: not handling ldm with s-bit set <3>Alignment trap: not handling instruction %08lx at [<%08lx>] Alignment trap: %s (%d) PC=0x%08lx Instr=0x%08lx Address=0x%08lx FSR 0x%03x cpualignmentalignment exceptionEBSA285<4>Warning: bad NeTTrom parameters detected, using defaults Rebel-NetWinderChalice-CATSCompaq-PersonalServer @`cascadepic1pic2W83977AF configurationSoundBlaster: DSP reset failed SoundBlaster: DSP not ready SoundBlaster: could not turn speaker off PCI: device %02x:%02x has unknown irq line %x <3>PCI: %02X:%02X [%04X:%04X] unknown device <3>schedule_timeout: wrong timeout value %lx from %p Scheduling in interrupt WTZDSR%-13.13s current %08lX %5lu %5d %6d %5d %7d %5d (L-TLB) (NOTLB) free sibling task PC stack pid father child younger older UGH! (%d:%d) was on the runqueue, removing. signal_actCannot create signal action SLAB cachefiles_cacheCannot create files SLAB cachefs_cacheCannot create fs_struct SLAB cachevm_area_structvma_init: Cannot alloc vm_area_struct SLAB cachemm_structvma_init: Cannot alloc mm_struct SLAB cacheLinuxpersonality-%ld%d-%d %-16s [%s] kernelfake_utsnametracedefhandler_libcsodefhandler_lcall7defhandler_elfdefhandler_coffabi<0>Kernel panic: %s <0>In interrupt handler - not syncing <0>In idle task - not syncing <0>Rebooting in %d seconds..Tainted: %c%cNot taintedkernel BUG in header file at line %d ttyS<0>%s<3>Aiee, inter_module_register: cannot kmalloc entry for '%s' <3>inter_module_register: duplicate im_name '%s'<3>inter_module_unregister: no entry for '%s', probably caused by previous kmalloc failure <3>inter_module_unregister: no entry for '%s'<3>inter_module_put: no entry for '%s'<3>init_module: Invalid module header size. <3>A new version of the modutils is likely needed. <3>init_module: Size of initialized module exceeds size of created module. <3>init_module: mod->name out of bounds. <3>init_module: mod->syms out of bounds. <3>init_module: mod->deps out of bounds. <3>init_module: mod->init out of bounds. <3>init_module: mod->cleanup out of bounds. <3>init_module: mod->ex_table_* invalid. <3>init_module: mod->flags invalid. <3>init_module: mod->can_unload out of bounds. <3>init_module: mod->kallsyms out of bounds. <3>init_module: mod->kallsyms invalid. <3>init_module: mod->archdata out of bounds. <3>init_module: mod->archdata invalid. <3>init_module: mod->kernel_data must be zero. <3>init_module: get_mod_name failure. <3>init_module: changed module name to `%s' from `%s' <3>init_module: self-referential dependency in mod->deps. <3>init_module: found dependency that is (no longer?) a module. %8lu%4ld (deleted) (autoclean) (unused) (initializing) (uninitialized) [ ] %-20s%8lu%0*lx %s [%s] %0*lx %s task releasing itself Aiee, killing interrupt handler!Attempted to kill the idle task!Attempted to kill init!Attempt to kill tasklet from interrupt ksoftirqd_CPU%dspawn_ksoftirqd() failed for cpu %d PCI IOPCI mem%*s%0*lx-%0*lx : %s check-regionTrying to free nonexistent resource <%08lx-%08lx> reserveddevdebugfsprocnetvmkerneloverflowgidoverflowuidrandomthreads-maxcad_pidsemmsgmnbmsgmnimsgmaxshmmnishmallshmmaxrtsig-maxrtsig-nraccthotplugmodprobeprintkctrl-alt-delreal-root-devcap-boundtaintedcore_patterncore_setuid_okcore_uses_pidpanicdomainnamehostnameversionosreleaseostypeblock_dumplaptop_modemax_map_countmax-readaheadmin-readaheadpage-clusterpagetable_cachekswapdovercommit_memorybdflushvm_passesvm_lru_balance_ratiovm_mapped_ratiovm_cache_scan_ratiovm_vfs_scan_ratiovm_gfp_debuglease-break-timedir-notify-enableleases-enabledentry-statefile-maxfile-nrinode-stateinode-nr<4>SYSCTL: Can't register %s <1>Help - malformed sysctl tree on free %d%lu<6>Process accounting paused <6>Process accounting resumed 8D"4B"0@",>"(<"bug: kernel timer added twice at %p. <5>Clock: inserting leap second 23:59:60 UTC <5>Clock: deleting leap second 23:59:59 UTC uid_cacheCannot create uid taskcount SLAB cache sigqueuesignals_init(): cannot create sigqueue SLAB cache<0>Restarting system. <0>System halted. <0>Power down. <0>Restarting system with command '%s'. PATH=/sbin:/usr/sbin:/bin:/usr/binTERM=linuxHOME=/-s-k--<3>kmod: failed to exec %s -s -k %s, errno = %d <3>request_module[%s]: Root fs not mounted <3>kmod: runaway modprobe loop assumed and stopped <3>request_module[%s]: fork failed, errno %d <3>request_module[%s]: waitpid(%d,...) failed, errno %d <3>%s(): keventd has not started current_is_keventdschedule_taskkeventdnr_sectors is %d cdroms/cdrom%dmemory.cforget_pte: old mapping existed! do_wp_page: bogus page at address %08lx <3>buggy mmap operation: [<%p>] nr_sectors is %d <7>%s: dirtied page filemap.cPage-cache hash table entries: %d (order: %ld, %ld bytes) Failed to allocate page hash table mprotect.cmremap.cvmalloc.c<2>Whee.. Swapped out page in kernel page table <3>alloc_area_pte: page already exists <3>Trying to vfree() bad address (%p) <3>Trying to vfree() nonexistent vm area (%p) size-%Zdsize-%Zd(DMA)<3>kmem_create: %sForcing size word alignment - %s kmem_cache_create: couldn't create cache %s. <3>kmem_cache_destroy: Can't free all objects %p slabinfo - version: 1.1 broken%-17s %6lu %6lu %6u %4lu %4lu %4uhm, page %08lx reserved twice. <1>bootmem alloc of %lu bytes failed! Out of memoryvmscan.ckswapdStarting kswapd rw_swap_page: bad swap file HighMemNormalDMA<5>__alloc_pages: %u-order allocation failed (gfp=0x%x/%i) Free pages: %6dkB (%6dkB HighMem) Zone:%s freepages:%6lukB ( Active: %d, inactive: %d, free: %d ) %lu*%lukB = %lukB) On node %d totalpages: %lu zone(%lu): %lu pages. BUG: wrong zone alignment, it will crash setup_mem_frac: %d setup_lower_zone_reserve: Swap cache: add %lu, delete %lu, find %lu/%lu, race %lu+%lu nr_sectors is %d Bad swap file entry Unused swap file entry Bad swap offset entry Unused swap offset entry <3>swap_free: %s%08lx swapfile.c<4>swapoff: cleared swap entry overflow Filename Type Size Used Priority %-31s file partition %d %d %d Unable to start swapping: out of memory :-) SWAP-SPACESWAPSPACE2Unable to find swap-space signature <4>Unable to handle swap header version %d <4>Swap area shorter than signature indicates <4>Empty swap-file <6>Adding Swap: %dk swap-space (priority %d) <4>swap_dup: swap entry overflow <3>swap_dup: %s%08lx <3>rw_swap_page: %s%08lx <3>rw_swap_page: no swap file or device <3>Out of Memory: Killed process %d (%s). Out of memory and no killable processes... ,<3>tmpfs: No value for mount option '%s' sizenr_blocksnr_inodesmodeuidgid<3>tmpfs: Bad mount option %s <3>tmpfs: Bad value '%s' for mount option '%s' shmtmpfs<3>Could not register tmpfs <3>Could not register shm fs <3>Could not kern_mount tmpfs dev/zero%p: %2d %p [%c%c%c] %c%c [%c] anon: %d, slab: %d, reserved: %d, free: %d total %ld, free %ld ----- Zone %d ------ ===== Node %d ===== Page InfopaGeinfo<3>chown_common: NULL inode <4>get_unused_fd: slot %d not NULL! <3>VFS: Close: file count is 0 Character devices: %3d %s char-major-%d%02x:%02xunknown-char%s(%d,%d)<7>init_special_inode: bogus imode (%o) <4>VFS: filp allocation failed <6>VFS: file-max limit %d reached nr_sectors is %d invalidate: dirty buffer invalidate: busy buffer %s: dirtied buffer <3>VFS: brelse: Trying to free free buffer brw_kiovec: iobuf not initialisedbrw_page: page not locked for I/ONo block device for %s Buffer memory: %6dkB Cache memory: %6ldkB <6>Buffer cache hash table entries: %d (order: %d, %ld bytes) Failed to allocate buffer hash table bdflushkupdatedlockfs%s %s nodevunlockfs: no s_root, dev %s unlockfs: no super found, dev %s <3>VFS: Busy inodes after unmount. Self-destruct in 5 seconds. Have a nice day... nr_sectors is %d bdev:bdevbdev_cacheCannot create bdev_cache SLAB cacheCannot register bdev pseudo-fsCannot create bdev pseudo-fs Block devices: %3d %s block-major-%dVFS: busy inodes on changed media. unknown-block%s(%d,%d)cdev_cacheCannot create cdev_cache SLAB cache<3>mem_map disagrees with %p at %08lx binfmt-%04x%d%ld%s.%d[%lu]pipe:(pipefsusr/gnemul/bsd/<3>kill_fasync: bad magic number in fasync_struct! fasync_cachecannot create fasync slab cache...Attempting to free lock with active wait queueAttempting to free lock with active block listAttempting to free lock on active lock list<3>locks_insert_block: removing duplicated lock (pid=%d %Ld-%Ld type=%d) <3>locks_delete_lock: fasync == %p <3>locks_conflict(): impossible lock type - %d <6>lease broken - owner pid = %d %d:%s %6s %s ACCESSPOSIX MANDATORYADVISORY *NOINODE*FLOCK MSNFS FLOCK ADVISORY LEASE BREAKING ACTIVE BREAKER UNKNOWN UNKNOWN %s RW READ WRITENONE UNLCK%d %s:%ld %Ld EOF %08lx %08lx %08lx %08lx %08lx ->file_lock_cachecannot create file lock slab cache/p<4>VFS: moving negative dcache entry (deleted)dentry_cacheCannot create dentry cache<6>Dentry cache hash table entries: %d (order: %ld, %ld bytes) Failed to allocate dcache hash table buffer_headCannot create buffer head SLAB cachenames_cacheCannot create names SLAB cachefilpCannot create filp SLAB cachedquotCannot create dquot SLAB cache<3>write_inode_now: no super block <6>Inode cache hash table entries: %d (order: %ld, %ld bytes) Failed to allocate inode hash table inode_cachecannot create inode slab cache<3>%s array = 0 (num = %d) free_fd_arrayfree_fdsetkiobufCannot create kiobuf SLAB cachednotify_cachecannot create dnotify slab cachenfsd \,nodiratime,noatime,mand,sync,noexec,nodev,nosuidnone ro rw 0 0 rootfsCan't create rootfsCan't allocate initial namespacemnt_cacheCannot create vfsmount cacheFailed to allocate mount hash table <6>Mount cache hash table entries: %d (order: %ld, %ld bytes) undefinedgroupuser<3>dqput: dquot already on free list?? <3>VFS: dqget(): Quota invalidated in dqget()! <3>VFS: dqduplicate(): Invalidated quota to be duplicated! <3>VFS: dqduplicate(): Locked quota to be duplicated! <3>VFS: dqputduplicate(): Duplicated dquot put without duplicate reference. <4>VFS: Adding dquot with dq_count %d to dispose list. : warning, : write failed, file limit reached. file quota exceeded too long. file quota exceeded. block limit reached. block quota exceeded too long. block quota exceeded. syncsfree_dquotsallocated_dquotscache_hitswritesreadsdropslookupsquotafs<5>VFS: Disk quotas v%s dquot_6.5.1<4>VFS: dquota write failed on dev %s '<6>VFS: %s: Refusing to turn on old quota format on given file. It probably contains newer quota format. ELF/usr/lib/libc.so.1/usr/lib/ld.so.1%d<3>Unable to load interpreter %.128s sizeof(elf_gregset_t) (%ld) != sizeof(struct pt_regs) (%ld) CORERSDZTDelf_core_dump: file->f_pos (%ld) != offset (%ld) mb_cache<3>cache %s: %d orphaned entries de_put: entry %s already free! de_put: deferred delete of %s ,uidgidproc_iget: using deleted entry %s, count=%d proc_read_super: get root inode failed procnetsysvipcsyssys/fssys/fs/binfmt_miscfsdriverbus/procmountsexerootcwdmemmapsstatmstatcmdlinestatusenvironfd...procfs: impossible type (%d)%dself...remove_proc_entry: %s/%s busy, count=%d Name: W (paging)T (stopped)Z (zombie)D (disk sleep)S (sleeping)R (running)State: %s Tgid: %d Pid: %d PPid: %d TracerPid: %d Uid: %d %d %d %d Gid: %d %d %d %d FDSize: %d Groups: %d VmSize: %8lu kB VmLck: %8lu kB VmRSS: %8lu kB VmData: %8lu kB VmStk: %8lu kB VmExe: %8lu kB VmLib: %8lu kB SigPnd: SigBlk: SigIgn: SigCgt: CapInh: %016x CapPrm: %016x CapEff: %016x %d (%s) %c %d %d %d %d %d %lu %lu %lu %lu %lu %lu %lu %ld %ld %ld %ld %ld %ld %lu %lu %ld %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %d %d array.c%d %d %d %d %d %d %d %08lx-%08lx %c%c%c%c %08lx %02x:%02x %lu %n%*c%d-%d%dsystem:/dev/ttysystem:consolesystem:vtmastersystemconsoleserial:calloutserialpty:masterpty:slaveptytype:%d.%d%-20s /dev/%-8s %3d %7s %s unknown%-10s %2d ???ttytty/ldisctty/drivertty/ldiscstty/drivers%d.%02d %d.%02d %d.%02d %d/%d %d %lu.%02lu %lu.%02lu total: used: free: shared: buffers: cached: Mem: %8Lu %8Lu %8Lu %8Lu %8Lu %8Lu Swap: %8Lu %8Lu %8Lu MemTotal: %8lu kB MemFree: %8lu kB MemShared: %8lu kB Buffers: %8lu kB Cached: %8lu kB SwapCached: %8lu kB Active: %8u kB Inactive: %8u kB HighTotal: %8lu kB HighFree: %8lu kB LowTotal: %8lu kB LowFree: %8lu kB SwapTotal: %8lu kB SwapFree: %8lu kB cpu %u %u %u %lu cpu%d %u %u %u %lu page %u %u swap %u %u intr %u %u disk_io: (%u,%u):(%u,%u,%u,%u,%u) ctxt %u btime %lu processes %lu %s execdomainsswapslockscmdlinefilesystemsinterruptsdevicesstatversionmeminfouptimeloadavgmountsself/mountskmsgcpuinfoioportsiomempartitionsslabinfoksymsmoduleskcoreprofileELFCOREvmlinuxnr_sectors is %d BUG: dst underflow %d: %p %02x%02x%02x%02x-%02x%02x-%02x%02x-%02x%02x-%02x%02x%02x%02x%02x%02x%s/c%dd%d%s/c%dd%dp%dhd%s%d%s/d%d%s/d%dp%d%s%c%s%c%c%d p%d<6>Partition check: <6> /dev/%s:<6> %s: unable to read partition table unknown partition table part%d../../%s/disc%ddiscsdisc%ddiscnr_sectors is %d p%d??? %s: <%s: > bsdnetbsdopenbsd [EZD] [DM6:DDO] [DM6:MBR] [DM6:AUX] [PTBL] < > <3>%s: aborting transaction: %s in %s__ext3_journal_get_undo_access__ext3_journal_get_write_access__ext3_journal_dirty_data__ext3_journal_revoke__ext3_journal_get_create_access__ext3_journal_dirty_metadataext3_journal_startDetected aborted journalext3_get_group_descblock_group >= groups_count - block_group = %d, groups_count = %luGroup descriptor not loaded - block_group = %d, group_desc = %lu, desc = %luread_block_bitmapCannot read block bitmap - block_group = %d, block_bitmap = %luload_block_bitmap__load_block_bitmapblock_group != block_bitmap_numberext3_free_blocks: nonexistent deviceext3_free_blocksFreeing blocks not in datazone - block = %lu, count = %luFreeing block in system zone - block = %lubit already cleared for block %lu<0>Assertion failure in %s() at %s:%d: "%s" balloc.cbh2jh(bitmap_bh)->b_committed_data != ((void *)0)find_next_usable_blockbh2jh(bh)->b_committed_dataext3_new_block: nonexistent deviceext3_new_blockAllocating block in system zone - block = %u!test_bit(j, bh->b_data)!test_bit(j, bh2jh(bh)->b_committed_data)block(%d) >= blocks count(%d) - block_group = %d, es == %p rec_len is smaller than minimalrec_len % 4 != 0rec_len is too small for name_lendirectory entry across blocksinode out of boundsbad entry in directory #%lu: %s - offset=%lu, inode=%lu, rec_len=%d, name_len=%dext3_readdirdirectory #%lu contains a hole at offset %lu<3>%s: aborting transaction: %s in %s__ext3_journal_get_undo_access__ext3_journal_get_write_access__ext3_journal_dirty_data__ext3_journal_revoke__ext3_journal_get_create_access__ext3_journal_dirty_metadataext3_journal_startDetected aborted journal<3>%s: aborting transaction: %s in %s__ext3_journal_get_undo_access__ext3_journal_get_write_access__ext3_journal_dirty_data__ext3_journal_revoke__ext3_journal_get_create_access__ext3_journal_dirty_metadataext3_journal_startDetected aborted journal<0>Assertion failure in %s() at %s:%d: "%s" ext3_sync_filefsync.cext3_journal_current_handle() == 0<3>%s: aborting transaction: %s in %s__ext3_journal_get_undo_access__ext3_journal_get_write_access__ext3_journal_dirty_data__ext3_journal_revoke__ext3_journal_get_create_access__ext3_journal_dirty_metadataext3_journal_startDetected aborted journalread_inode_bitmapCannot read inode bitmap - block_group = %lu, inode_bitmap = %uload_inode_bitmapblock_group >= groups_count - block_group = %d, groups_count = %lublock_group != inode_bitmap_numberext3_free_inode: inode has no device ext3_free_inode: inode has count=%d ext3_free_inode: inode has nlink=%d ext3_free_inode: inode on nonexistent device ext3_free_inodereserved or nonexistent inode %lubit already cleared for inode %luext3_new_inodebit already set for inode %dFree inodes count corrupted in group %dreserved inode or inode > inodes count - block_group = %d,inode=%dext3_orphan_getbad orphan ino %lu! e2fsck was run? inode bitmap error for orphan %lu bad orphan inode %lu! e2fsck was run? <5>ext3_test_bit(bit=%d, block=%ld) = %d <5>inode=%p <5>is_bad_inode(inode)=%d <5>NEXT_ORPHAN(inode)=%u <5>max_ino=%lu <3>%s: aborting transaction: %s in %s__ext3_journal_get_undo_access__ext3_journal_get_write_access__ext3_journal_dirty_data__ext3_journal_revoke__ext3_journal_get_create_access__ext3_journal_dirty_metadataext3_journal_startDetected aborted journalext3_forgeterror %d when attempting revokestart_transactionext3_delete_inodeext3_block_to_pathblock < 0block > bigext3_alloc_branchext3_splice_branch<0>Assertion failure in %s() at %s:%d: "%s" ext3_get_block_handleinode.chandle != NULL || create == 0ext3_get_blockhandle != 0ext3_getblkcreate != 0do_journal_get_write_accessext3_prepare_writejournal_dirty_sync_datajournal_dirty_async_datacommit_write_fnext3_commit_writeext3_writepagePageLocked(page)ext3_block_truncate_pageext3_clear_blocksext3_free_dataext3_free_branchesRead failure, inode=%ld, block=%ldext3_truncateext3_get_inode_locbad inode number: %lugroup >= groups countDescriptor not loadedunable to read inode block - inode=%lu, block=%luext3_do_update_inodeext3_setattr<0>%s: called with no handle! ext3_mark_iloc_dirtyext3_reserve_inode_write<0>%s: transactions do not match! ext3_dirty_inodeext3_change_inode_journal_flag<3>%s: aborting transaction: %s in %s__ext3_journal_get_undo_access__ext3_journal_get_write_access__ext3_journal_dirty_data__ext3_journal_revoke__ext3_journal_get_create_access__ext3_journal_dirty_metadataext3_journal_startDetected aborted journalext3_ioctl<3>%s: aborting transaction: %s in %s__ext3_journal_get_undo_access__ext3_journal_get_write_access__ext3_journal_dirty_data__ext3_journal_revoke__ext3_journal_get_create_access__ext3_journal_dirty_metadataext3_journal_startDetected aborted journalext3_find_entryext3_add_entryext3_delete_entryext3_createext3_mknodext3_mkdir...empty_dirbad directory (dir #%lu) - no data blockbad directory (dir #%lu) - no `.' or `..'<0>Assertion failure in %s() at %s:%d: "%s" ext3_orphan_addnamei.c(S_ISREG(inode->i_mode) || S_ISDIR(inode->i_mode) || S_ISLNK(inode->i_mode)) || inode->i_nlink == 0ext3_orphan_delext3_rmdirempty directory has nlink!=2 (%d)ext3_unlinkDeleting nonexistent file (%lu), %dext3_symlinkext3_linkext3_rename<3>%s: aborting transaction: %s in %s__ext3_journal_get_undo_access__ext3_journal_get_write_access__ext3_journal_dirty_data__ext3_journal_revoke__ext3_journal_get_create_access__ext3_journal_dirty_metadataext3_journal_startDetected aborted journalnr_sectors is %d EXT3-fs (device %s): panic forced after error <2>Remounting filesystem read-only <2>EXT3-fs error (device %s): %s: %s IO failureOut of memoryJournal has abortedReadonly filesystemerror %d<2>EXT3-fs error (device %s) in %s: %s <2>ext3_abort called. EXT3-fs panic (device %s): %s: %s <2>EXT3-fs abort (device %s): %s: %s <4>EXT3-fs warning (device %s): %s: %s ext3_update_dynamic_revupdating to rev %d because of new feature flag, running e2fsck is recommended<3>EXT3: failed to open journal device %s: %d <3>sb orphan head is %d <3>sb_info orphan list: <3> inode 0x%04x:%ld at %p: mode %o, nlink %d, next %d <0>Assertion failure in %s() at %s:%d: "%s" ext3_put_supersuper.clist_empty(&sbi->s_orphan)<5>EXT3-fs: the %s option needs an argument <5>EXT3-fs: Invalid %s argument: %s ,bsddfnouid32abortchecknone<3>EXT3 Check option not supported debugerrorscontinueremount-ropanic<3>EXT3-fs: Invalid errors option: %s grpidbsdgroupsminixdfnochecknogrpidsysvgroupsresgidresuidsbgrpquotanoquotaquotausrquotajournal<3>EXT3-fs: cannot specify journal on remount updatenoloaddataorderedwriteback<3>EXT3-fs: Invalid data option: %s <3>EXT3-fs: cannot change data mode on remount commit<3>EXT3-fs: Unrecognized mount option %s <3>EXT3-fs warning: revision level too high, forcing read-only mode <4>EXT3-fs warning: mounting unchecked fs, running e2fsck is recommended <4>EXT3-fs warning: mounting fs with errors, running e2fsck is recommended <4>EXT3-fs warning: maximal mount count reached, running e2fsck is recommended <4>EXT3-fs warning: checktime reached, running e2fsck is recommended <6>[EXT3 FS %s, %s, bs=%lu, gc=%lu, bpg=%lu, ipg=%lu, mo=%04lx] 2.4-0.9.1919 August 2002<6>EXT3 FS 2.4-0.9.19, 19 August 2002 on %s, external journal on %s internal journal ext3_check_descriptorsBlock bitmap for group %d not in group (block %lu)!Inode bitmap for group %d not in group (block %lu)!Inode table for group %d not in group (block %lu)!<6>EXT3-fs: %s: orphan cleanup on readonly fs <7>%s: truncating inode %ld to %Ld bytes ext3_orphan_cleanup<7>%s: deleting unreferenced inode %ld <6>EXT3-fs: %s: %d orphan inode%s deleted s<6>EXT3-fs: %s: %d truncate%s cleaned up <3>EXT3-fs: unable to read superblock <3>VFS: Can't find ext3 filesystem on dev %s. <4>EXT3-fs warning: feature flags set on rev 0 fs, running e2fsck is recommended <3>EXT3-fs: %s: couldn't mount because of unsupported optional features (%x). <3>EXT3-fs: %s: couldn't mount RDWR because of unsupported optional features (%x). <3>EXT3-fs: Unsupported filesystem blocksize %d on %s. <3>EXT3-fs: blocksize %d too small for device blocksize %d. <3>EXT3-fs: Can't read superblock on 2nd try. <3>EXT3-fs: Magic mismatch, very weird ! <3>EXT3-fs: unsupported inode size: %d <3>EXT3-fs: fragsize %lu != blocksize %u (unsupported) <3>EXT3-fs: #blocks per group too big: %lu <3>EXT3-fs: #fragments per group too big: %lu <3>EXT3-fs: #inodes per group too big: %lu <3>EXT3-fs: not enough memory <3>EXT3-fs: can't read group descriptor %d <3>EXT3-fs: group descriptors corrupted ! <3>ext3: No journal on filesystem on %s <3>EXT3-fs: Journal does not support requested data journaling mode <3>EXT3-fs: corrupt root inode, run e2fsck <3>EXT3-fs: get root inode failed <6>EXT3-fs: recovery complete. <6>EXT3-fs: mounted filesystem with %s data mode. <3>EXT3-fs: no journal found. <3>EXT3-fs: journal inode is deleted. <3>EXT3-fs: invalid journal inode. <3>EXT3-fs: Could not load journal inode <3>EXT3-fs: blocksize too small for journal device. <3>EXT3-fs: couldn't read superblock of external journal <3>EXT3-fs: external journal has bad superblock <3>EXT3-fs: journal UUID does not match <3>EXT3-fs: failed to create device journal <3>EXT3-fs: I/O error on journal device <3>EXT3-fs: External journal has more than one user (unsupported) - %d <6>EXT3-fs: INFO: recovery required on readonly filesystem. <3>EXT3-fs: write access unavailable, cannot proceed. <6>EXT3-fs: write access will be enabled during recovery. <3>EXT3-fs: filesystem has both journal and inode journals! <3>EXT3-fs: error updating journal. <3>EXT3-fs: error loading journal. <3>EXT3-fs: readonly filesystem when trying to create journal. <6>EXT3-fs: creating new journal on inode %d <3>EXT3-fs: error creating journal. ext3_clear_journal_errFilesystem error recorded from previous mount: %sMarking fs in need of filesystem check.ext3_remountAbort forced by user<4>EXT3-fs: %s: couldn't remount RDWR because of unsupported optional features (%x). ext3_write_dquotext3get_transaction<0>Assertion failure in %s() at %s:%d: "%s" transaction.c!journal->j_commit_timer_activejournal->j_running_transaction == NULLstart_this_handlejournal->j_running_transactionnew_handlejournal_starthandle->h_transaction->t_journal == journaljournal_try_startjournal_restarttransaction->t_updates > 0journal_current_handle() == handlejournal_unlock_updatesjournal->j_barrier_count != 0do_get_write_accessjh->b_transaction == transaction || jh->b_transaction == journal->j_committing_transactionjh->b_next_transaction == transactionjh->b_next_transaction == ((void *)0)handle->h_buffer_credits > 0jh->b_transaction == journal->j_committing_transaction<0>%s: OOM for frozen_buffer !jh->b_next_transaction<3>EXT3-fs unexpected failure: %s; (((jh2bh(jh))->b_state & (1UL << BH_Uptodate)) != 0)<3>Possible IO failure. journal_get_create_access(jh->b_transaction == transaction || jh->b_transaction == ((void *)0) || (jh->b_transaction == journal->j_committing_transaction && jh->b_jlist == 4))(((jh2bh(jh))->b_state & (1UL << BH_Lock)) != 0)journal_get_undo_access<0>%s: No memory for committed data! jh->b_committed_datajournal_dirty_datajh->b_jlist != 6journal_dirty_metadatajh->b_transaction != ((void *)0)jh->b_jlist != 1jh->b_frozen_data == 0journal_forget!jh->b_frozen_data!jh->b_committed_data(jh->b_transaction == journal->j_committing_transaction)journal_stop__journal_unfile_bufferjh->b_jlist < 9transaction != 0transaction->t_nr_buffers >= 0<3>%s: page index:%lu count:%d flags:%lx debug_page<3>%s: bh b_next:%p blocknr:%lu b_list:%u state:%lx journal_try_to_free_buffersPageLocked(page)journal_unmap_bufferjh->b_next_transaction == journal->j_running_transactiontransaction == journal->j_running_transaction!buffer_jdirty(bh)journal_flushpagepage->buffers == NULL__journal_file_bufferjh->b_transaction == transaction || jh->b_transaction == 0__journal_refile_bufferjh->b_transaction->t_state == T_RUNNING<0>Assertion failure in %s() at %s:%d: "%s" journal_commit_transactioncommit.cjournal->j_running_transaction != NULLjournal->j_committing_transaction == NULLcommit_transaction->t_state == T_RUNNINGcommit_transaction->t_outstanding_credits <= journal->j_max_transaction_bufferscommit_transaction->t_sync_datalist != 0commit_transaction->t_sync_datalist == NULLcommit_transaction->t_async_datalist == NULLbufs == 0jh->b_transaction != ((void *)0)((&bh->b_count)->counter) == 0buffer_jdirty(bh)commit_transaction->t_shadow_list == NULLcommit_transaction->t_buffers == NULLcommit_transaction->t_checkpoint_list == NULLcommit_transaction->t_iobuf_list == NULLcommit_transaction->t_log_list == NULLjh->b_transaction == commit_transaction || jh->b_transaction == journal->j_running_transactioncommit_transaction != cp_transaction!(((bh)->b_state & (1UL << BH_Dirty)) != 0)jh->b_next_transaction == ((void *)0)commit_transaction->t_state == T_COMMITcommit_transaction == journal->j_committing_transaction<3>JBD: bad block at offset %u <0>Assertion failure in %s() at %s:%d: "%s" jreadrecovery.coffset < journal->j_maxlen<3>JBD: Failed to read block at offset %u <3>JBD: error %d scanning journal <3>JBD: IO error %d recovering block %ld in log do_one_passobh != NULL<3>JBD: Out of memory during recovery. <3>JBD: recovery pass %d ended at transaction %u, expected %u <0>Assertion failure in %s() at %s:%d: "%s" __flush_buffercheckpoint.cjh->b_transaction == ((void *)0)!test_bit(BH_JWrite, &bh->b_state)log_do_checkpointdrop_count != 0 || cleanup_ret != 0cleanup_journal_tailblocknr != 0__journal_insert_checkpoint(((jh2bh(jh))->b_state & (1UL << BH_Dirty)) != 0) || buffer_jdirty(jh2bh(jh))jh->b_cp_transaction == ((void *)0)__journal_drop_transactiontransaction->t_ilist == NULLtransaction->t_buffers == NULLtransaction->t_sync_datalist == NULLtransaction->t_async_datalist == NULLtransaction->t_forget == NULLtransaction->t_iobuf_list == NULLtransaction->t_shadow_list == NULLtransaction->t_log_list == NULLtransaction->t_checkpoint_list == NULLtransaction->t_updates == 0list_empty(&transaction->t_jcb)transaction->t_journal->j_committing_transaction != transactionrevoke_recordrevoke_table<0>Assertion failure in %s() at %s:%d: "%s" journal_init_revokerevoke.cjournal->j_revoke == NULL(hash_size & (hash_size-1)) == 0journal_destroy_revokelist_empty(hash_list)Cannot set revoke feature!journal_revoke!"Cannot set revoke feature!"!test_bit(BH_Revoked, &bh->b_state)kjournald<6>kjournald starting. Commit interval %ld seconds <0>Assertion failure in %s() at %s:%d: "%s" journal_write_metadata_bufferjournal.cbuffer_jdirty(jh2bh(jh_in))<5>%s: ENOMEM at get_unused_buffer_head, trying again. journal_next_log_blockjournal->j_free > 1<1>%s: journal block not found at offset %lu on %s journal_bmapjournal_init_commonjournal_init_devbh != NULL<3>%s: Cannnot locate journal superblock journal_init_inode<3>Journal length (%d blocks) too short. <0>%s: creation of journal on external device! journal_createjournal_get_superblock<3>JBD: IO error reading journal superblock <4>JBD: no valid journal superblock found <4>JBD: unrecognised superblock format ID <4>JBD: journal file too short <4>JBD: Unrecognised features on journal <4>JBD: recovery failed journal_destroyjournal->j_running_transaction == NULLjournal->j_committing_transaction == NULLjournal->j_checkpoint_transactions == NULL<4>JBD: Converting superblock from version 1 to 2. journal_flush!journal->j_running_transaction!journal->j_committing_transaction!journal->j_checkpoint_transactionsjournal->j_head == journal->j_tailjournal->j_tail_sequence == journal->j_transaction_sequencejournal_wipe!(journal->j_flags & JFS_LOADED)<4>JBD: %s recovery information on journal ClearingIgnoring<3>Aborting journal on device %s. %sUnexpected dirty buffer encountered at %s:%d (%s blocknr %lu) <4><5>ENOMEM in %s, retrying. journal_init_journal_head_cachejournal_head_cache == 0journal_head<0>JBD: no memory for journal_head cache journal_destroy_journal_head_cachejournal_head_cache != NULLjournal_alloc_journal_headjournal_add_journal_head(((&bh->b_count)->counter) > 0) || (bh->b_page && bh->b_page->mapping)bh->b_journal_head != ((void *)0)__journal_remove_journal_headjh->b_jcount >= 0buffer_jbd(bh)jh2bh(jh) == bhjournal_unlock_journal_headjh->b_jcount > 0<6>Journalled Block Device driver loaded ext2_get_group_descblock_group >= groups_count - block_group = %d, groups_count = %luGroup descriptor not loaded - block_group = %d, group_desc = %lu, desc = %luread_block_bitmapCannot read block bitmap - block_group = %d, block_bitmap = %luload_block_bitmap__load_block_bitmapblock_group != block_bitmap_numberext2_free_blocks: nonexistent deviceext2_free_blocksFreeing blocks not in datazone - block = %lu, count = %luFreeing block in system zone - block = %lubit already cleared for block %luext2_new_block: nonexistent deviceext2_new_blockFree blocks count corrupted for block group %dAllocating block in system zone - block = %ubit already set for block %dblock(%d) >= blocks count(%d) - block_group = %d, es == %p ext2_check_pagesize of directory #%lu is not a multiple of chunk sizerec_len is smaller than minimalunaligned directory entryrec_len is too small for name_lendirectory entry across blocksinode out of boundsbad entry in directory #%lu: %s - offset=%lu, inode=%lu, rec_len=%d, name_len=%dentry in directory #%lu spans the page boundaryoffset=%lu, inode=%lu...read_inode_bitmapCannot read inode bitmap - block_group = %lu, inode_bitmap = %luload_inode_bitmapblock_group >= groups_count - block_group = %d, groups_count = %lublock_group != inode_bitmap_numberext2_free_inodereserved or nonexistent inode %lubit already cleared for inode %luext2_new_inodereserved inode or inode > inodes count - block_group = %d,inode=%ldFree inodes count corrupted in group %dext2_block_to_pathblock < 0block > bigext2_free_branchesRead failure, inode=%ld, block=%ldext2_read_inodebad inode number: %lugroup >= groups countDescriptor not loadedunable to read inode block - inode=%lu, block=%luext2_write_inodeIO error syncing ext2 inode [%s:%08lx] nr_sectors is %d EXT2-fs panic (device %s): %s: %s <2>EXT2-fs error (device %s): %s: %s Remounting filesystem read-only <4>EXT2-fs warning (device %s): %s: %s ext2_update_dynamic_revupdating to rev %d because of new feature flag, running e2fsck is recommended,bsddfnouid32checknoneEXT2 Check option not supported debugerrorsEXT2-fs: the errors option requires an argument continueremount-ropanicEXT2-fs: Invalid errors option: %s grpidbsdgroupsminixdfnochecknogrpidsysvgroupsresgidEXT2-fs: the resgid option requires an argument EXT2-fs: Invalid resgid option: %s resuidEXT2-fs: the resuid option requires an argumentEXT2-fs: Invalid resuid option: %s sbEXT2-fs: the sb option requires an argumentEXT2-fs: Invalid sb option: %s grpquotanoquotaquotausrquotaEXT2-fs: Unrecognized mount option %s EXT2-fs warning: revision level too high, forcing read-only mode EXT2-fs warning: mounting unchecked fs, running e2fsck is recommended EXT2-fs warning: mounting fs with errors, running e2fsck is recommended EXT2-fs warning: maximal mount count reached, running e2fsck is recommended EXT2-fs warning: checktime reached, running e2fsck is recommended [EXT II FS %s, %s, bs=%lu, fs=%lu, gc=%lu, bpg=%lu, ipg=%lu, mo=%04lx] 0.5b95/08/09ext2_check_descriptorsBlock bitmap for group %d not in group (block %lu)!Inode bitmap for group %d not in group (block %lu)!Inode table for group %d not in group (block %lu)!EXT2-fs: unable to set blocksize %d EXT2-fs: unable to read superblock VFS: Can't find ext2 filesystem on dev %s. EXT2-fs warning: feature flags set on rev 0 fs, running e2fsck is recommended EXT2-fs: %s: couldn't mount because of unsupported optional features (%x). EXT2-fs: %s: couldn't mount RDWR because of unsupported optional features (%x). ext2_read_supermounting ext3 filesystem as ext2 <3>EXT2-fs: blocksize too small for device. EXT2-fs: Couldn't read superblock on 2nd try. EXT2-fs: Magic mismatch, very weird ! EXT2-fs: unsupported inode size: %d VFS: Can't find an ext2 filesystem on dev %s. VFS: Unsupported blocksize on dev %s. EXT2-fs: fragsize %lu != blocksize %lu (not supported yet) EXT2-fs: #blocks per group too big: %lu EXT2-fs: #fragments per group too big: %lu EXT2-fs: #inodes per group too big: %lu EXT2-fs: not enough memory EXT2-fs: unable to read group descriptors EXT2-fs: group descriptors corrupted! <3>EXT2-fs: corrupt root inode, run e2fsck <3>EXT2-fs: get root inode failed EXT2-fs: %s: couldn't remount RDWR because of unsupported optional features (%x). ext2ramfsrootfs<2>%s(%p): poisoned pointer devfs_putForcing Oops <2>%s(%p): root entry being freed <3>%s(%s): not a directory _devfs_search_dir<3>%s(%s): dir: "%s" is not a directory _devfs_append_entry.devfsd../<3>%s(%s): could not create parent path _devfs_prepare_leaf<3>%s(%s): could not allocate entry <3>%s(%p): not a directory _devfs_find_by_dev<3>%s(%s): too short _devfs_find_entry<3>%s(): NULL name pointer devfs_register<3>%s(%s): NULL ops pointer <3>%s(%s): NULL ops, got %p from major table <3>%s(%s): creating directories is not allowed <3>%s(%s): creating symlinks is not allowed <3>%s(%s): exhausted %s device numbers charblock<3>%s(%s): could not prepare leaf <3>%s(%s): illegal mode: %x <3>%s(%s): could not append to parent, err: %d devfs_do_symlink<3>%s(%s): NULL link pointer devfs_mk_dir<3>%s(%s): using old entry in dir: %p "%s" <3>%s(%s): could not append to dir: %p "%s", err: %d <3>%s(%s): only one slave allowed devfs_auto_unregister<2>%s(): old slave: "%s" new slave: "%s" mountonlyno<7>VFS: Disk change detected on device %s <4>VFS: busy inodes on changed media.. disc<3>%s(%s): new_inode() failed, de: %p _devfs_get_vfs_inode<3>%s(%d): no block device from bdget() ...<2>%s(%s): de: %p dentry: %p de->dentry: %p devfs_d_iput<3>%s(): get root inode failed devfs_read_superdevfs<6>%s: v%s Richard Gooch (rgooch@atnf.csiro.au) 1.12c (20020818)devfsd_event<2>%s(): unable to allocate event slab init_devfs_fs<6>%s: boot_options: 0x%0x none/dev<6>Mounted devfs on /dev <3>%s(): unable to mount devfs, err: %d mount_devfs_fstapes../tape%u<3>%s(): major %d was already free devfs_dealloc_major<3>%s(): device %s was already free devfs_dealloc_devnum<3>%s(): major for %s not previously allocated <3>%s(): number %d was already free devfs_dealloc_unique_numberunknownNFS: nfs_readdir_filler() reading cookie %Lu into page %lu. NFS: found cookie %Lu NFS: find_dirent() returns %d NFS: find_dirent_page() searching directory page %ld NFS: find_dirent_page() returns %d NFS: readdir_search_pagecache() searching for cookie %Lu NFS: readdir_search_pagecache() returned %d NFS: nfs_do_filldir() filling starting @ cookie %Lu NFS: nfs_do_filldir() filling ended @ cookie %Lu; returning = %d NFS: uncached_readdir() searching for cookie %Lu NFS: uncached_readdir() returns %d nfs_lookup_validate: %s/%s has dud inode NFS: dentry_delete(%s/%s, %x) NFS: lookup(%s/%s) NFS: create(%x/%ld, %s NFS: mknod(%x/%ld, %s NFS: mkdir(%x/%ld, %s NFS: rmdir(%x/%ld, %s NFS: silly-rename(%s/%s, ct=%d) NFS: silly-renaming %s/%s, negative dentry?? .nfs%*.*lx%*.*xtrying to rename %s to %s NFS: safe_remove(%s/%s) nfs_safe_remove: %s/%s busy, d_count=%d NFS: unlink(%x/%ld, %s) NFS: symlink(%x/%ld, %s, %s) nfs_proc_symlink: %s/%s not negative! nfs_proc_symlink: %s/%s already exists?? NFS: link(%s/%s -> %s/%s) NFS: rename(%s/%s -> %s/%s, ct=%d) nfs_rename: target %s/%s busy, d_count=%d unknownnfs: flush(%x/%ld) nfs: read(%s/%s, %lu@%lu) nfs: mmap(%s/%s) nfs: fsync(%x/%ld) nfs: write(%s/%s(%ld), %lu@%lu) <6>NFS: attempt to write to active swap file! NFS: nfs_lock(f=%4x/%ld, t=%x, fl=%x, r=%Ld:%Ld) unknown<3>NFS: Invalid unlock attempted <3>NFS: unlocked request attempted removed from list! nfs_flushdNFS: writecache_init NFS: reqlist_exit (ptr %p rpc %p) NFS: %4d flushd starting NFS: %4d flushd back to sleep unknownnfsNFS: delete_inode(%x/%ld) <3>nfs_delete_inode: inode %ld has pending RPC requests <5>nfs_get_root: getattr error = %d nfs warning: mount version %s than kernel oldernewer<5>NFS: NFSv3 not supported by mount program. <5>NFS: cannot retrieve file system info. <5>NFS: cannot initialize writeback cache. nfs_read_super: get root inode failed <4>NFS: couldn't start rpciod! <4>NFS: cannot create RPC client. <4>NFS: cannot create RPC transport. NFS: mount program didn't pass remote address! nfs_read_super: missing data argument nfs_statfs: statfs error = %d ,noacl,broken_suid,lock,nolock,noac,nocto,udp,tcp,posix,intr,hard,soft,v%d,rsize=%d,wsize=%d,acregmin=%d,acregmax=%d,acdirmin=%d,acdirmax=%d,addr= \NFS: nfs_fhget(%s/%s fileid=%Ld) NFS: Buggy server - nlink == 0! NFS: __nfs_fhget(%x/%Ld ct=%d) __nfs_fhget: iget failed nfs_notify_change: revalidate failed, error=%d nfs_notify_change: attr=%Ld, fattr=%Ld?? NFS: revalidating (%x/%Ld) nfs_revalidate_inode: (%x/%Ld) getattr failed, error=%d nfs_revalidate_inode: (%x/%Ld) refresh failed, error=%d NFS: (%x/%Ld) revalidation complete NFS: refresh_inode(%x/%ld ct=%d info=0x%x) <3>nfs_refresh_inode: inode number mismatch expected (0x%x/0x%Lx), got (0x%x/0x%Lx) <7>nfs_refresh_inode: inode %ld mode changed, %07o to %07o unknown<4>NFS: READ reply header overflowed:length %d > %Zu NFS: READ header is short. iovec will be shifted. <4>NFS: server cheating in read reply: count %d > recvd %d RPC: readres OK count %d <4>NFS: READDIR reply header overflowed:length %d > %Zu NFS: READDIR header is short. iovec will be shifted. <4>NFS: giant filename in readdir (len 0x%x)! <5>NFS: readdir reply truncated! NFS: READLINK header is short. iovec will be shifted. <3>nfs_stat_to_errno: bad nfs status return value: %d nfs_statfsnfs_readdirnfs_rmdirnfs_mkdirnfs_symlinknfs_linknfs_renamenfs_removenfs_createnfs_writenfs_writecachenfs_readnfs_readlinknfs_lookupnfs_rootnfs_setattrnfs_getattrnfs_nullunknown<3>NFS: Invalid unlock attempted <3>NFS: unlocked request attempted removed from list! <3>NFS: Add to list failed! nfs_page<6>nfs_page: not all structures were freed unknownNFS call getroot NFS reply getroot NFS call getattr NFS reply getattr NFS call setattr NFS reply setattr NFS call lookup %s NFS reply lookup: %d NFS call readlink NFS reply readlink: %d NFS call read %d @ %Ld NFS reply read: %d NFS call write %d @ %Ld NFS reply write: %d NFS call create %s NFS reply create: %d NFS call mknod %s NFS reply mknod: %d NFS call remove %s NFS reply remove: %d NFS call rename %s -> %s NFS reply rename: %d NFS call link %s NFS reply link: %d NFS call symlink %s -> %s NFS reply symlink: %d NFS call mkdir %s NFS reply mkdir: %d NFS call rmdir %s NFS reply rmdir: %d NFS call readdir %d NFS reply readdir: %d NFS call statfs NFS reply statfs: %d unknown<3>NFS: Invalid unlock attempted <3>NFS: unlocked request attempted removed from list! NFS: nfs_readpage_sync(%p) NFS: nfs_proc_read(%s, (%x/%Ld), %u, %u, %p) NFS: %4d initiated read call (req %x/%Ld count %u. <3>NFS: desynchronized value of nfs_i.nread. NFS: %4d nfs_readpage_result, (status %d) NFS: read (%x/%Ld %d@%Ld) NFS: nfs_readpage (%p %ld@%lu) Aiee.. nfs swap-in of page failed! nfs_read_data<6>nfs_read_data: not all structures were freed unknownunknownnfs_delete_queueunknown<3>NFS: Invalid unlock attempted <3>NFS: unlocked request attempted removed from list! NFS: nfs_writepage_sync(%x/%Ld %d@%Ld) NFS: short write, wsize=%u, result=%d <3>NFS: unlocked request attempted hashed! <3>NFS: unlocked request attempted unhashed! <3>NFS: desynchronized value of nfs_i.npages. <3>NFS: desynchronized value of nfs_i.ndirty. <3>NFS: desynchronized value of nfs_i.ncommit. NFS: nfs_updatepage(%s/%s %d@%Ld) NFS: nfs_updatepage returns %d (isize %Ld) NFS: %4d initiated write call (req %x/%Ld count %u) NFS: %4d nfs_writeback_done (status %d) <4>NFS: Server wrote less than requested. NFS: faulty NFSv3 server %s: (committed = %d) != (stable = %d) NFS: write (%x/%Ld %d@%Ld), error = %d OK marked for commit NFS: %4d initiated commit call NFS: %4d nfs_commit_done (status %d) NFS: commit (%x/%Ld %d@%Ld) mismatch nfs_write_data<6>nfs_write_data: not all structures were freed unknownNFS call getroot NFS reply getroot NFS call getattr NFS reply getattr NFS call setattr NFS reply setattr NFS call lookup %s NFS reply lookup: %d NFS call access NFS reply access NFS call readlink NFS reply readlink: %d NFS call read %d @ %Ld NFS reply read: %d NFS call write %d @ %Ld NFS call create %s NFS reply create: %d NFS call setattr (post-create) NFS reply setattr (post-create): %d NFS call remove %s NFS reply remove: %d NFS call rename %s -> %s NFS reply rename: %d NFS call link %s NFS reply link: %d NFS call symlink %s -> %s NFS reply symlink: %d NFS call mkdir %s NFS reply mkdir: %d NFS call rmdir %s NFS reply rmdir: %d NFS call readdir %d NFS reply readdir: %d NFS call mknod %s %x NFS reply mknod: %d NFS call fsstat NFS reply statfs: %d unknown<4>NFS: READDIR reply header overflowed:length %d > %Zu NFS: READDIR header is short. iovec will be shifted. <4>NFS: giant filename in readdir (len %x)! <4>NFS: giant filehandle in readdir (len %x)! <5>NFS: readdir reply truncated! NFS: READLINK header is short. iovec will be shifted. <4>NFS: READ count doesn't match RPC opaque count. <4>NFS: READ reply header overflowed:length %d > %Zu NFS: READ header is short. iovec will be shifted. <4>NFS: server cheating in read reply: count %d > recvd %d nfs3_commitnfs3_pathconfnfs3_fsinfonfs3_fsstatnfs3_readdirplusnfs3_readdirnfs3_linknfs3_renamenfs3_rmdirnfs3_removenfs3_mknodnfs3_symlinknfs3_mkdirnfs3_createnfs3_writenfs3_readnfs3_readlinknfs3_accessnfs3_lookupnfs3_setattrnfs3_getattrnfs3_nullunknown%d: %08x %08x %08x %08x %08x %08x<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%s) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! <5>lockd: CANCEL call failed (errno %d) NLM: reclaiming locks for host %s%s-reclaimunknown%d: %08x %08x %08x %08x %08x %08x<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%s) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! %d@%s<5>NFSv4 file locking not implemented! lockd: clnt proc returns %d nlmclnt_alloc_call: failed, waiting for memory lockd: call procedure %s on %s lockd: rpc_call returned error %d lockd: server in grace period <4>lockd: spurious grace period reject?! lockd: server returns status %d lockd: call procedure %s on %s (async) <5>lockd: failed to monitor %s <4>lockd: failed to reclaim lock for pid %d (errno %d, status %d) lockd: unexpected unlock status: %d lockd: unlock failed (err = %d) <4>lockd: unexpected unlock status: %d lockd: CANCEL call error %d, retrying. lockd: cancel status %d (task %d) lockd: CANCEL failed (server has no locks) <5>lockd: weird return %d for CANCEL call <5>lockd: unexpected status NLM_BLOCKED <5>lockd: unexpected server status %d unknown%d: %08x %08x %08x %08x %08x %08x<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%s) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! <5>lockd: no clnt or addr in lookup_host! lockd: nlm_lookup_host(%08x, p=%d, v=%d) lockd: creating host entry %d.%d.%d.%dlockd: nlm_bind_host(%08x) lockd: next rebind in %ld jiffies lockd: couldn't create RPC handle for %s lockd: rebind host %s lockd: get host %s lockd: release host %s lockd: shutting down host module lockd: nuking all hosts... <4>lockd: couldn't shutdown host module! lockd: %d hosts left: %s (cnt %d use %d exp %ld) lockd: host garbage collection lockd: delete host %s <4>lockd: active RPC handle unknown%d: %08x %08x %08x %08x %08x %08x<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%s) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! lockdNFS locking service started (ver 0.4). <4>lockd: terminating on error %d lockd: request from %08x <7>lockd: new process, skipping host shutdown <4>lockd_up: no pid, %d users?? <4>lockd_up: create service failed <4>lockd_up: makesock failed, error=%d <4>lockd_up: create thread failed, error=%d <4>lockd_down: no users! pid=%d <4>lockd_down: no lockd running. <4>lockd_down: lockd failed to exit, clearing pid unknown%d: %08x %08x %08x %08x %08x %08x<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%s) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! lockd: nlmsvc_insert_block(%p, %ld) lockd: nlmsvc_lookup_block f=%p pd=%d %Ld-%Ld ty=%d lockd: check f=%p pd=%d %Ld-%Ld ty=%d cookie=%s cookie: head of blocked queue %p, block %p lockd: created block %p... lockd: deleting block %p... lockd: deleting granted lock lockd: unblocking blocked lock lockd: nlmsvc_lock(%04x/%ld, ty=%d, pi=%d, %Ld-%Ld, bl=%d) lockd: posix_lock_file returned %d lockd: blocking on this lock (allocating). lockd: blocking on this lock. lockd: nlmsvc_testlock(%04x/%ld, ty=%d, %Ld-%Ld) lockd: conflicting lock(ty=%d, %Ld-%Ld) somehostlockd: nlmsvc_unlock(%04x/%ld, pi=%d, %Ld-%Ld) lockd: nlmsvc_cancel(%04x/%ld, pi=%d, %Ld-%Ld) lockd: VFS unblock notification for block %p <4>lockd: notification for unknown block! lockd: grant blocked lock %p lockd: lock still blocked <4>lockd: unexpected error %d in %s! nlmsvc_grant_blockedlockd: GRANTing blocked lock. lockd: GRANT_MSG RPC callback callback: looking for cookie %s, host %u.%u.%u.%u lockd: no block for cookie %s, host %u.%u.%u.%u grant_reply: looking for cookie %x, host (%08x), s=%d nlmsvc_retry_blocked(%p, when=%ld) nlmsvc_retry_blocked(%p, when=%ld, done=%d) unknown%d: %08x %08x %08x %08x %08x %08x<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%s) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! unknown%d: %08x %08x %08x %08x %08x %08x<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%s) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! <5>lockd: unauthenticated request from (%08x:%d) lockd: NULL called lockd: TEST called lockd: TEST status %d vers %d lockd: LOCK called lockd: LOCK status %d lockd: CANCEL called lockd: CANCEL status %d lockd: UNLOCK called lockd: UNLOCK status %d lockd: GRANTED called lockd: GRANTED status %d lockd: TEST_MSG called lockd: LOCK_MSG called lockd: CANCEL_MSG called lockd: UNLOCK_MSG called lockd: GRANTED_MSG called lockd: SHARE called lockd: SHARE status %d lockd: UNSHARE called lockd: UNSHARE status %d lockd: NM_LOCK called lockd: SM_NOTIFY called <4>lockd: rejected NSM callback from %08x:%d lockd: GRANTED_RES called lockd: %4d callback failed (errno = %d) unknown%d: %08x %08x %08x %08x %08x %08x<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%s) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! lockd: nlm_file_lookup(%08x %08x %08x %08x %08x %08x) lockd: creating file for (%08x %08x %08x %08x %08x %08x) lockd: open failed (nfserr %d) lockd: found file %p (count %d) lockd: closing file %s/%ld <4>lockd: attempt to release unknown file! lockd: unlock failure in %s:%d svcsubs.clockd: nlm_release_file(%p, ct = %d) lockd: nlmsvc_mark_resources lockd: nlmsvc_free_host_resources <4>lockd: couldn't remove all locks held by %slockd: invalidating client for %s unknown%d: %08x %08x %08x %08x %08x %08x<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%s) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! <7>nsm_mon_unmon: rpc failed, status=%d lockd: nsm_monitor(%s) <5>lockd: cannot monitor %s lockd: nsm_unmonitor(%s) <5>lockd: cannot unmonitor %s localhostnsm: xdr_encode_mon(%08x, %d, %d, %d) %d.%d.%d.%dnsm: xdr_decode_stat_res status %d state %d sm_notifysm_simu_crashsm_unmon_allsm_unmonsm_monsm_statsm_nullstatdunknown%d: %08x %08x %08x %08x %08x %08x<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%s) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! <5>lockd: bad cookie size %d (only cookies under %d bytes are supported.) <5>lockd: bad fhandle size %d (should be %d) nlm_undefnlm_granted_resnlm_unlock_resnlm_canc_resnlm_lock_resnlm_test_resnlm_granted_msgnlm_unlock_msgnlm_canc_msgnlm_lock_msgnlm_test_msgnlm_grantednlm_unlocknlm_cancnlm_locknlm_testnlm_nulllockd???...%02xunknown%d: %08x %08x %08x %08x %08x %08x<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%s) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! unknown%d: %08x %08x %08x %08x %08x %08x<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%s) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! <5>lockd: bad cookie size %d (only cookies under %d bytes are supported.) <5>lockd: bad fhandle size %d (should be <=%d) xdr: before encode_testres (p %p resp %p) xdr: encode_testres (status %d pid %d type %d start %Ld end %Ld) xdr: after encode_testres (p %p resp %p) nlm4_undefnlm4_granted_resnlm4_unlock_resnlm4_canc_resnlm4_lock_resnlm4_test_resnlm4_granted_msgnlm4_unlock_msgnlm4_canc_msgnlm4_lock_msgnlm4_test_msgnlm4_grantednlm4_unlocknlm4_cancnlm4_locknlm4_testnlm4_nullunknown%d: %08x %08x %08x %08x %08x %08x<3>fh_copy: copying %s/%s, already verified! nfsd: inode locked twice during operation. nfsd: fh_lock(%s) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! <5>lockd: unauthenticated request from (%08x:%d) lockd: NULL called lockd: TEST4 called lockd: TEST4 status %d lockd: LOCK called lockd: LOCK status %d lockd: CANCEL called lockd: CANCEL status %d lockd: UNLOCK called lockd: UNLOCK status %d lockd: GRANTED called lockd: GRANTED status %d lockd: TEST_MSG called lockd: LOCK_MSG called lockd: CANCEL_MSG called lockd: UNLOCK_MSG called lockd: GRANTED_MSG called lockd: SHARE called lockd: SHARE status %d lockd: UNSHARE called lockd: UNSHARE status %d lockd: NM_LOCK called lockd: SM_NOTIFY called <4>lockd: rejected NSM callback from %08x:%d lockd: GRANTED_RES called lockd: %4d callback failed (errno = %d) Unable to load NLS charset %s: name too long nls_%sUnable to load NLS charset %s defaultiso8859-1...%ddevpts_put_super: badness: entry %d count %d ,uidgidmodedevpts: called with bogus options devpts: get root dentry failed devpts<3>ipc_init_ids() failed, ipc service disabled. sysvipc/msg key msqid perms cbytes qnum lspid lrpid uid gid cuid cgid stime rtime ctime %10d %10d %4o %10lu %10lu %5u %5u %5u %5u %5u %5u %10lu %10lu %10lu sysvipc/semfreeundos undo list error id=%d sem_exit undo list error id=%d key semid perms nsems uid gid cuid cgid otime ctime %10d %10d %4o %10lu %5u %5u %5u %5u %10lu %10lu sysvipc/shmSYSV%08x key shmid perms size cpid lpid nattch uid gid cuid cgid atime dtime ctime %10d %10d %4o %10u %5u %5u %5d %5u %5u %5u %5u %10lu %10lu %10lu %10d %10d %4o %21u %5u %5u %5d %5u %5u %5u %5u %10lu %10lu %10lu uart_close: bad serial port count; tty->count is 1, state->count is %d rs_close: bad serial port count for %s%d: %d unknown%d: uart:%s port:%08X irq:%d tx:%d rx:%d fe:%d pe:%d brk:%d oe:%d|RTS|CTS|DTR|DSR|CD|RIserinfo:1.0 driver%s%s revision:%s %s%d at I/O 0x%xI/O 0x%x offset 0x%xMMIO 0x%lx (irq = %d) is a %s <1>Removing wrong port: %p != %p <3>Attempt to unregister %s%d rs285serial_21285tts/FB%dcua/FB%d<3>Couldn't register 21285 serial driver <3>Couldn't register 21285 callout driver <3>Unable to unregister 21285 callout driver (%d) <3>Unable to unregister 21285 driver (%d) boot no options ,$  @@RSAXR16850ST1665416C950/954StartechTI16750ST16650V2ST16650Cirrus16550A16550164508250unknown<3>serial8250: too much work for irq%d serialttyS%d: LSR safety check engaged! ttyS%d - enabling bad tx status workarounds serial-rsacua/%dtts/%d<7>Local i960 firmware missing<6>Redundant entry in serial pci_table. Please send the output of lspci -vv, this message (%d,%d,%d,%d) and the manufacturer and name of serial board or modem board to serial-pci-info@lists.sourceforge.net. serial Txph,`tXh Purandomrandomfullzeroportnullkmemmemunable to get major %d for memory devs NULL tty<4>Warning: bad magic number for tty struct (%s) in %s <4>Warning: null TTY for (%s) in %s <4>Warning: dev (%s) tty->count(%d) != #fd's(%d) in %s <0>tty_ldisc_deref: no references. tty-ldisc-%dCouldn't open N_TTY ldisc for %s --- error %d.<4>tty_check_change: tty->pgrp <= 0! do_tty_hanguptty_readtty_write<3>init_dev but no ldisc <6>init_dev: ldisc open failed, clearing slot %d release_dev<7>release_dev: bad idx when trying to free (%s) <7>release_dev: driver.table[%d] not tty for (%s) <7>release_dev: driver.termios[%d] not termios for (%s) <7>release_dev: driver.termios_locked[%d] not termios_locked for (%s) <7>release_dev: other->table[%d] not o_tty for (%s) <7>release_dev: other->termios[%d] not o_termios for (%s) <7>release_dev: other->termios_locked[%d] not o_termios_locked for (%s) <7>release_dev: bad pty pointers <4>release_dev: %s: read/write wait queue active! <4>release_dev: bad pty slave count (%d) for %s <4>release_dev: bad tty->count (%d) for %s tty_open<4>tty_io.c: process %d (%s) used obsolete /dev/%s - update software to use /dev/ttyS%d tty_polltty_fasynctty_ioctl<4>Use of setserial/setrocket to set SPD_* flags is deprecated <3>Attempt to register invalid minor number with devfs (%d:%d). /dev/ttyCouldn't register /dev/tty driver /dev/consoleCouldn't register /dev/console driver /dev/ptmxCouldn't register /dev/ptmx driver /dev/vc/0Couldn't register /dev/tty0 driver <4>%s: %d input overrun(s) %s: unknown flag %d read_chan: tty->pgrp <= 0! n_tty_read_chan: called with read_buf == NULL?!? n_tty<4>Warning?!? termios_locked is NULL. nr_sectors is %d rawmaster pty_close: count = %d!! pty_ioctl called with NULL tty! pty_unix98_ioctl called with NULL tty! pty_masterpty/m%dpty_slavepty/s%dCouldn't register pty driverCouldn't register pty slave driverptspty: %d Unix98 ptys configured ptmpts/%dCouldn't register Unix98 ptm driver major %dCouldn't register Unix98 pts driver major %dhead%3i %s char-major-%d-%dmiscunable to get major %d for misc devices n;AvXaM ְdx <5>get_random_bytes called before random driver initialization %02x%02x%02x%02x-%02x%02x-%02x%02x-%02x%02x-%02x%02x%02x%02x%02x%02xuuidboot_idwrite_wakeup_thresholdread_wakeup_thresholdentropy_availpoolsizea%uvcsunable to get major %d for vcs devicevcc0a[%d;%dR[?6c%c%c%ccon_write: tty %d not allocated vc/%dCouldn't register console driver Console: %s %s %dx%dcolourmono Console: switching consoles %d-%d to %s %s %dx%d to %s unblank_screen: tty %d not allocated ?? <4>selection: kmalloc() failed <3>keyboard.c: do_lowercase was called - impossible <3>do_fn called with value=%d 0123456789+-*/ ,.?()#pqrstuvwxylSRQMnnmPQSBDCA<4>Keyboard timed out[1] <6>keyboard: unknown e1 escape sequence <6>keyboard: unknown scancode e0 %02x <6>keyboard: unrecognized scancode (%02x) - ignored <6>PS/2 mouse reconnect detected <3>pc_keyb: controller jammed (0x%02X). <4>keyboard: Timeout - AT keyboard not present?(%02x) <4>keyboard: Too many NACKs -- noisy kbd cable? Keyboard failed self testKeyboard interface failed self testKeyboard reset failed, no ACKKeyboard reset failed, no PORDisable keyboard: no ACKEnable keyboard: no ACKSet rate: no ACKSet rate: no 2nd ACKkeyboard<4>initialize_kbd: %s <6>Detected PS/2 Mouse Port. PS/2 Mousepsaux<3>psaux_init(): out of memory max-user-freqrtcdev<3>rtc: I/O resource %lx is not free. <3>rtc: IRQ %d is not free. driver/rtc<6>Real Time Clock Driver v1.10f <4>rtc: lost some interrupts at %ldHz. rtc_time : %02d:%02d:%02d rtc_date : %04d-%02d-%02d rtc_epoch : %04lu alarm : %02d:**:%02d ** DST_enable : %s BCD : %s 24hr : %s square_wave : %s alarm_IRQ : %s update_IRQ : %s periodic_IRQ : %s periodic_freq : %ld batt_status : %s yesnookaydeadon (hardwired)onoffThermostat: HI %i.%i, LOW %i.%i; temperature: %i.%i C, fan %s temptherm<3>therm: unable to register /proc/therm <6>Thermostat: high %i.%i, low %i.%i, current %i.%i C, fan %s. nr_sectors is %d request list leak! blk_cleanup_queue: leaked requests (%d) blk_cleanup_queue: leaked sectors (%d) blk: queue %p, no I/O memory limit I/O limit %luMb (mask 0x%Lx) <3>drive_stat_acct: cmd not R/W? blk: reads: %u blk: writes: %u blk: r/w: %u + %u > %u elevator returned crap (%d) <6>attempt to access beyond end of device <6>%s: rw=%d, want=%ld, limit=%d <3>generic_make_request: Trying to access nonexistent block-device %s (%ld) <7>%s: %s block %lu/%u on %s WRITEREAD<5>ll_rw_block: device %s: only %d-char blocks implemented (%u) <5>Can't write to read-only device %s end_request: I/O error, dev %s (%s), sector %lu end_request: buffer-list destroyed blkdev_requestsCan't create request pool slab cache nr_sectors is %d nr_sectors is %d major minor #blocks name rio rmerge rsect ruse wio wmerge wsect wuse running use aveq %4d %4d %10d %s %u %u %u %u %u %u %u %u %d %u %u nr_sectors is %d nr_sectors is %d ramdisk<6>RAMDISK: bad command: %d RAMDISK: wrong blocksize %d, reverting to defaults RAMDISK: Could not get major %drd%uinitrdRAMDISK driver initialized: %d RAM disks of %dK size %d blocksize <3>alloc_dev: Unable to allocate device memory. eth%dfddi%dhip%dtr%dfc%dBUG: dst underflow %d: %p dlcicomxlapbcomxppphdlc_keepalivehw_rxhw_txcomx_txcomx_rx<3>comx_debug: PANIC! len = %d !!! %s: %s NULL skb %s: %s empty skb %s: %s len %d %04d %02x%c%s boardtypeprotocol<5>Interface %s: modem status %s, line protocol %s UPDOWNLOOP<3>comx_xmit: %s: skb->len %d > dev->mtu %d comx_xmit skbcomx_rx skbInterface administrative status is %s, modem status is %s, protocol is %s IDLEBUSYNOT READYModem status changes: %lu, Transmitter status is %s, tbusy: %d Interface load (input): %d / %d / %d bits/s (%d%c%s) /%s (output): %d / %d / %d bits/s (%sDebug flags: %s %s noneRX errors: len: %lu, overrun: %lu, crc: %lu, aborts: %lu buffer overrun: %lu, pbuffer overrun: %lu TX errors: underrun: %lu Line status: driver not initialized Board status: driver not initialized statuslineup_delay%01d boardtypesprotocols<3>count is %lu > %d!!! debug<3>Invalid debug option comx-hw-%scomx-proto-%s<3>comx: invalid lineup_delay value <3>%s: down interface before removing it <3>COMX: lookup error <6>COMX: driver for hardware type %s, version %s <6>COMX: driver for protocol type %s, version %s comx<6>COMX: driver version %s (C) 1995-1999 ITConsult-Pro Co. 0.85nr_sectors is %d aliALI15X3PIO modeDMA modeFIFO On FIFO Off 8T 6T 4T3.5T 3T2.5T 2T1.5Terror DRQ busyerror DRQ error busy error DRQ busy DRQ busy OK ??? ??? Ali M15x3 Chipset. ------------------ PCI Clock: %d. CD_ROM FIFO:%s, CD_ROM DMA:%s YesNo FIFO Status: contains %d Words, runs%s%s OVERWR OVERRD..-------------------primary channel-------------------secondary channel--------- channel status: %s %s On Offboth channels togth: %s %s Channel state: %s %s Add. Setup Timing: %dT %dT Command Act. Count: %dT %dT Command Rec. Count: %dT %dT ----------------drive0-----------drive1------------drive0-----------drive1------ DMA enabled: %s %s %s %s FIFO threshold: %2d Words %2d Words %2d Words %2d Words FIFO mode: %s %s %s %s Dt RW act. Cnt %2dT %2dT %2dT %2dT Dt RW rec. Cnt %2dT %2dT %2dT %2dT -----------------------------------UDMA Timings-------------------------------- UDMA: %s %s %s %s UDMA timings: %s %s %s %s OKNoWDC   <3>Warning: ATI Radeon IGP Northbridge is not yet fully tested. ALI15x3 IDEnr_sectors is %d @, clocks=%d/%d/%d %s: bad news in cmd640_tune_drive %s: %sabled cmd640 fast host timing (devsel) endis%s: %sabled cmd640 prefetch %s: selected cmd640 PIO mode%d (%dns)%s (overriding vendor mode)VLBPCI (type1)PCI (type2)<3>ide: cmd640 init failed: wrong value in reg 0x5b ide: bad cmd640 revision: %d %s: buggy cmd640%c interface on %s, config=0x%02x not probedokayalivenot cmd640enablednot responding<6>%s: %sserialized, secondary interface %s not cmd640: drive%d timings/prefetch cleared cmd640: drive%d timings/prefetch(%s) preservedoffonnr_sectors is %d W82C105%s: selected %s (%dns) (%04X) sl82c105: lost IRQ: resetting host sl82c105: drive was requesting IRQ, but host lost it sl82c105: DMA was enabled <6>%s: DMA enabled %s: Winbond 553 bridge revision %d, BM-DMA disabled W82C105 IDEnr_sectors is %d Piccolo0105Piccolo0103Piccolo0102OPTI621VVIA_IDEHINT_IDEUM8886BFUM8886AUM8673FHT6565SAMURAINS87410<6>Skipping disabled %s IDE controller. PCI IDEnr_sectors is %d <3>%s: wait_for_ready, error status: %x status timeoutstatus error%s: Speed warnings UDMA 3/4/5 is not functional. %s: CHECK for good STATUS set_drive_speed_status<2>%s: ide_set_handler: handler not null; old=%p, new=%p %s: ATAPI reset complete %s: ATAPI reset timed-out, status=0x%02x <3>%s: host reset_poll failure for %s. %s: reset timed-out, status=0x%02x %s: reset: success master: passedformatter device errorsector buffer errorECC circuitry errorcontrolling MPU errorerror (0x%02x?); slave: failed nr_sectors is %d %s: %s: status=0x%02x { Busy DriveReady DeviceFault SeekComplete DataRequest CorrectedError Index Error } %s: %s: error=0x%02xDriveStatusError Bad%sCRC Sector UncorrectableError SectorIdNotFound TrackZeroNotFound AddrMarkNotFound , LBAsect=%lld, LBAsect=%d, CHS=%d/%d/%d, sector=%luset_multmodeset_geometry_intrrecal_intrtask_no_data_intrtask_in_intr%s: MULTI-READ assume all data transfered is bad status=0x%02x task_mulin_intr<3>%s: no DRQ after issuing WRITE%s _EXTtask_out_intr<3>%s: no DRQ after issuing %s MULTWRITE_EXTMULTWRITE<3>%s: MULTI-WRITE assume all data transfered is bad status=0x%02x task_mulout_intr<3>%s: %s Multimode Write multcount is not set ide_taskfile_ioctl<3>%s: %s Multimode Read failure multcount is not set flagged_task_no_data_intrflagged_task_no_data_intr (unexpected phase)flagged_task_in_intr (no data requested)flagged_task_in_intrflagged_task_in_intr (unexpected data phase)flagged_task_mulin_intr (no data requested)flagged_task_mulin_intr (multimode not set)flagged_task_mulin_intrflagged_task_mulin_intr (unexpected data phase)flagged_pre_task_out_intr (write data not specified)<3>%s: No DRQ bit after issuing write command. flagged_task_out_intrflagged_task_out_intr (unexpected data phase)flagged_pre_task_mulout_intr (write data not specified)flagged_pre_task_mulout_intr (multimode not set)flagged_task_mulout_intr (multimode not set)flagged_task_mulout_intrflagged_task_mulout_intr (unexpected data phase)nr_sectors is %d !"89XYZ[<6>ide: Assuming %dMHz system bus speed for PIO modes%s ; override with idebus=xx<4>%s: %s: status=0x%02x { Busy DriveReady DeviceFault SeekComplete DataRequest CorrectedError Index Error } %s: %s: error=0x%02xDriveStatusError Bad%s CRCSectorUncorrectableError SectorIdNotFound TrackZeroNotFound AddrMarkNotFound , LBAsect=%llu, high=%d, low=%d, LBAsect=%ld, CHS=%d/%d/%d, sector=%ldide-diskide-scsiide-cdide-tapeide-floppy<4>%s: driver not present capacityHUH? We are busy. <3>%s: drives not ready. <6>ide: drives found on hot-added interface. <3>%s: channel busy io_32bitkeepsettingsnice1pio_modeslowunmaskirqusing_dmainit_speedcurrent_speednumber<2>ide: failed to attach default driver. drive reset01234567890123456789abcdefhdideidebus<6>ide_setup: %side=nodma : Prevented DMA ide=reverse : Enabled support for IDE inverse scan order. nonenoprobenowerrcdromserializeautotunenoautotuneswapdatabswapflashremapnoremapscsistrokep x      T        ide- -- BAD LAST LUN! Expected value from 0 to 7 -- USE "ide%d=serialize" INSTEAD -- BAD BUS SPEED! Expected value from 20 to 66resetdmaata66minus8minus9minus10fourqd65xxht6560bcmd640_vlbdtc2278umc8672ali14xxdc4030x              $ -- SUPPORT NOT CONFIGURED IN THIS KERNEL -- BAD OPTION -- NOT SUPPORTED ON ide%dToo many IDE drivers<3>ide: late registration of driver. <3>%s: does not support hotswap of device class ! %s: attached %s driver. <6>flushing ide devices: %s <6>Uniform Multi-Platform E-IDE driver Revision: 7.00beta4-2.4 nr_sectors is %d UDMA 7UDMA 6UDMA 5UDMA 4UDMA 3UDMA 2UDMA 1UDMA 0MW DMA 2MW DMA 1MW DMA 0SW DMA 2SW DMA 1SW DMA 0PIO 4PIO 3PIO 2PIO 1PIO 0PIO SLOWXFER ERRORFX2}dPFx2dQUANTUM FIREBALL_1280QUANTUM FIREBALL_1080QUANTUM FIREBALL_640QUANTUM FIREBALL_540QUANTUM LIGHTNING 730AQUANTUM LIGHTNING 540AQUANTUM LPS540AQUANTUM LPS365AQUANTUM LPS270AQUANTUM LPS210AQUANTUM LPS240AQUANTUM ELS170AQUANTUM ELS127AST3491AST3144AST3290AST3600AST3390AST3391AST3655AST3630AST3660AST5660ASAMSUNG SHD-3172ASAMSUNG SHD-3122ASAMSUNG SHD-3121AMaxtor 7540 AVMaxtor 7546 ATMaxtor 7345 ATMaxtor 7245 ATMaxtor 7213 ATMaxtor 7171 ATMaxtor 7131 ATWDC AC31200WDC AC31000WDC AC280WDC AC1210WDC AC1170WDC AC1270WDC AC2850WDC AC2120WDC AC21200WDC AC2200WDC AC2250WDC AC2340WDC AC2420WDC AC2540WDC AC2700Conner Peripherals 540MB - CFS540Anr_sectors is %d cdroms/cdrom%ddrive_cmd<3>%s: bad device number: %s <3>%s%c: bad access: block=%ld, count=%ld <3>%s: drive not ready for command <3>ide_set_handler: timer already active <3>%s: Huh? nuking plugged queue <3>%s: error waiting for DMA dma timeout retry<3>%s: timeout waiting for DMA <3>ide_timer_expiry: hwgroup->drive was NULL <3>%s: ide_timer_expiry: hwgroup->busy was 0 ?? <3>%s: lost interrupt irq timeout<3>%s%s: unexpected interrupt, status=0x%02x, count=%ld (?)<3>%s: ide_intr: hwgroup->busy was 0 ?? <3>%s: ide_intr: huh? expected NULL handler on exit cdroms/cdrom%dnr_sectors is %d ide-default0.9.newide<3>ide-default: %s: Failed to register the driver with ide.c nr_sectors is %d KODAK ATA_FLASHHitachi CVSunDisk SDCFBSanDisk SDCFBHAGIWARA HPCLEXAR ATA_FLASHATA_FLASHE X A B Y T E N E S T%s: %s, ATAPI CD-ROMoppypoypZIPcdrom or floppy?, assuming FLOPPYCD/DVD-ROMTAPEOPTICALUNKNOWN (type %d) drive %s DISK drive CFAATA<6>%s: probing with STATUS(0x%02x) instead of ALTSTATUS(0x%02x) %s: IRQ probe failed (0x%lx) %s: no response (status = 0x%02x), resetting drive %s: no response (status = 0x%02x) %s: enabling %s -- failed (timeout) failed (status = 0x%02x) success <3>ide: out of memory for id data. UNKNOWN<6>%s: non-IDE drive, CHS=%d/%d/%d <6>%s: ATAPI cdrom (?) <4>%s: Unknown device on bus refused identification. Ignoring. <6>Probing IDE interface %s... <4>%s: reset <3>%s: ERROR, PORTS ALREADY IN USE <3>%s: ports already in use, skipping probe %s: potential irq problem with %s and %s %s at 0x%03lx-0x%03lx,0x%03lx on irq %d (%sed with %s)sharserializ hdhost%d/bus%d/target%d/lun%d<4>(ide::init_gendisk) Out of memory %s: DISABLED, NO IRQ %s: UNABLE TO GET MAJOR NUMBER %d %s: Disabled unable to get IRQ %d. %s: probed IRQ %d and default IRQ %d failed. %s: probed IRQ %d failed, using default. nr_sectors is %d  @ [remap +63] [remap 0->1]%s%s [%d/%d/%d]nr_sectors is %d proc_ide: error: %s: '%s' /proc/ide/%s/config: channel(s) busy, cannot write not a PCI deviceexpected 'R' or 'P'bad/missing register numbermissing ':'bad data, 2/4/8 digits requiredexpected whitespace after datamisaligned accessbyteworddwordproc_ide_write_config: error writing %s at bus %02x dev %02x reg 0x%x value 0x%x proc_ide_write_config: error %d parse error pci bus %02x device %02x vendor %04x device %04x channel %d proc_ide_read_config: error %d reading bus %02x dev %02x reg 0x%02x ??%c%02x%c(none) %s version %s (none)genericpcicmd640dtc2278ali14xxqd65xxumc8672ht6560bpdc4030rz1000trm290cmd646cy82c6934drivespmacacorn(unknown)%s %04x%cname value min max mode ---- ----- --- --- ---- %-24s%-16d%-16swrite-only%-16d%-16drwproc_ide_write_settings(): parse error %llu physical %d/%d/%d logical %d/%d/%d %.40s disk cdrom tape floppy UNKNOWN settingsmodelmediaidentifydriveride%d/%smateconfigchannelidedriverside/driversnr_sectors is %d <3>%s: port 0x%04lx already claimed by %s <3>%s: too many IDE interfaces, no room in table <6>%s: device not capable of full native PCI mode <6>%s: placing both ports into native PCI mode <3>%s: rewrite of PROGIF failed, wanted 0x%04x, got 0x%04x <3>%s: dma_base is invalid (0x%04lx) <6>%s: simplex device: DMA forced <6>%s: simplex device: DMA disabled <6>%s: unknown IDE controller at PCI slot %s, VID=%04x, DID=%04x <6>%s: IDE controller at PCI slot %s <4>%s: (ide_setup_pci_device:) Could not enable device. <4>%s: Not fully BIOS configured! <3>%s: can't set dma mask ide_tmp<6>%s: device disabled (BIOS) <3>%s: error accessing PCI regs <3>%s: unable to enable IDE controller <3>%s: IO baseregs (BIOS) are reported as MEM, report to . <3>%s: inconsistent baseregs (BIOS) for port %d, skipping <3>%s: %s error updating PCICMD <6>%s: %s Bus-Master DMA disabled (BIOS) <6>%s: device enabled (Linux) <6>%s: chipset revision %d <6>%s: not 100%% native mode: will probe irqs later <6>%s: will probe irqs later <4>%s: bad irq (%d): will probe later <6>%s: 100%% native mode on irq %d <6>%s: neither IDE port enabled (BIOS) nr_sectors is %d ST34342ACONNER CTT8000-ACONNER CTMA 4000ALLMicropolis 2112A_NEC DV5800AATAPI CD-ROM DRIVE 40X MAXIMUMPLEXTOR CD-R PX-W8432TSAMSUNG CD-ROM SN-124SAMSUNG CD-ROM SCSAMSUNG CD-ROM SC-148FSAMSUNG CD-ROM SC-148CWPI CDD-820RICOH CD-R/RW MP7083ACD-ROM Drive/F5AE-IDE CD-ROM CR-840CD-532E-ATOSHIBA CD-ROM XM-1702BCToshiba CD-ROM XM-6202BHITACHI CDR-8435HITACHI CDR-8335HITACHI CDR-8SANYO CD-ROM CRDSanDisk SDP3B-64SanDisk SDP3BCRD-84CRD-8482BCRD-8480CCRD-8480BCRD-8400BCompaq CRD-8241B21.10N21WDC AC23200L24.09P07WDC AC32100HWDC AC31600HWDC AC33100HWDC AC32500HWDC AC22100HWDC AC11000H%s: dma_intr: bad DMA status (dma_stat=%x) dma_intr%s: DMA table too small %s: empty DMA table? <4>%s: dma_timer_expiry: dma status == 0x%02x <6>%s: DMA disabled <4>%s: (%s) called while not waiting __ide_dma_test_irq%s: Disabling (U)DMA for %s , BUG DMA OFF, UDMA(mode 7), UDMA(133), UDMA(100), UDMA(66), UDMA(44), UDMA(33), UDMA(25), UDMA(16), (U)DMA, DMA, BUG<4>%s: chipset supported call only __ide_dma_retune%s: DMA interrupt recovery <3>%s: timeout waiting for DMA <3>%s: -- Error, unable to allocate%s%s table(s). CPU SG DMA DMA<6> %s: MMIO-DMA <6> %s: MMIO-DMA at 0x%08lx-0x%08lx -- Error, MMIO ports already in use. <6> %s: BM-DMA at 0x%04lx-0x%04lx -- Error, ports in use. -- Error, secondary ports in use. , BIOS settings: %s:%s, %s:%sDMApio nr_sectors is %d 48-bit Drive: %llu read_intr%s: write_intr error1: nr_sectors=%ld, stat=0x%02x write_intrmultwrite_intrRequest while ide driver is blocked?<3>%s: no DRQ after issuing %s MULTWRITEWRITE<3>%s: bad command: %d <6>%s: Write Cache FAILED Flushing! %s: %s: status=0x%02x { Busy DriveReady DeviceFault SeekComplete DataRequest CorrectedError Index Error } %s: %s: error=0x%02xDriveStatusError Bad%s CRCSectorUncorrectableError SectorIdNotFound TrackZeroNotFound AddrMarkNotFound , LBAsect=%llu, high=%d, low=%d, LBAsect=%ld, CHS=%d/%d/%d, sector=%ld<6>%s: Host Protected Area detected. current capacity is %ld sectors (%ld MB) native capacity is %ld sectors (%ld MB) <6>%s: Host Protected Area disabled. <6>%s: Host Protected Area detected. current capacity is %lld sectors (%lld MB) native capacity is %lld sectors (%lld MB) <3>%s: bad special flag: 0x%02x %i (none) %04x%csmart_thresholdssmart_valuesgeometrycachebios_cylbios_headbios_sectaddressbswapmultcountnowerrbreada_readaheadfile_readaheadmax_kb_per_requestlunwcacheacousticfailuresmax_failures%s: cannot use LBA48 - capacity reset from %llu to %llu <6>%s: %ld sectors (%ld MB) w/%dKiB Cacheide-disk1.17<3>ide-disk: %s: Failed to register the driver with ide.c <3>%s: INVALID GEOMETRY: %d PHYSICAL HEADS? <3>%s: cleanup_module() called while still busy <3>%s: Attempted to corrupt something: ide operation was pending accross suspend/resume. *How did you get that request through?!Handler was not set to panic?<4>PCI: Unable to reserve %s region #%d:%lx@%lx for device %s I/OmemPCI_CLASS=%04XPCI_ID=%04X:%04XPCI_SUBSYS_ID=%04X:%04XPCI_SLOT_NAME=%spciHOME=/PATH=/sbin:/bin:/usr/sbin:/usr/binACTION=addACTION=removecompat<7>PCI: cache line size of %d is not supported by device %s <3>PCI: Unable to handle 64-bit address for device %s Transparent bridge - %s <3>PCI: Unable to handle 64-bit address space for %s PCI CardBus #%02xPCI Bus #%02x%02x:%02x.%dPCI device %04x:%04x<3>PCI: device %s has unknown header type %02x, ignoring. <3>PCI: %s: class %x doesn't match header type %02x. Ignoring class. <3>pci_pool_destroy %s/%s, %p busy <3>pci_pool_free %s/%s, %p/%x (bad dma) <3>PCI: Unknown option `%s' <3>PCI: PIIX3: Enabling Passive Release on %s <6>Activating ISA DMA hang workarounds. <6>Disabling direct PCI/PCI transfers. <6>Limiting direct PCI/PCI transfers. <6>Applying VIA southbridge workaround. <6>ATI Northbridge, reserving I/O ports 0x3b0 to 0x3bb. RadeonIGP<6>PCI: Via IRQ fixup for %s, from %d to %d <4>I/O APIC: AMD Errata #22 may be present. In the event of instability try <4> : booting with the "noapic" option. <4>BIOS failed to enable PCI standards compliance, fixing this error. <6>PCI: Fixup for MediaGX/Geode Slave Disconnect Boundary (0x41=0x%02x) <6>PCI: Ignoring BAR%d-%d of IDE controller %s <6>PCI: C0 revision 450NX. Disabling PCI restreaming. <6>PCI: i801 SMBus device continues to play 'hide and seek'! 0x%x <6>PCI: Enabled i801 SMBus device PCI device %04x:%04xPCI device %04x:%04x (%s)%s %s (#%d)Signal processing controllerCommunication synchronizerPerformance countersDPIO moduleEncryption controllerEntertainment encryption deviceNetwork and computing encryption deviceSatellite data communication controllerSatellite voice communication controllerSatellite audio communication controllerSatellite TV controllerI2OWireless controllerRF controllerConsumer IR controllerIRDA controllerInfiniBandSMBusFibre ChannelUSB ControllerSSAACCESS BusFireWire (IEEE 1394)Co-processorMIPSPower PCAlphaPentium486386Docking StationGeneric Docking StationInput device controllerGameport controllerScanner controllerMouse controllerDigitizer PenKeyboard controllerSystem peripheralPCI Hot-plug controllerRTCTimerDMA controllerPICCommunication controllerModemMultiport serial controllerParallel controllerSerial controllerBridgeInfiniBand to PCI host bridgeSemi-transparent PCI-to-PCI bridgeRACEway bridgeCardBus bridgeNuBus bridgePCMCIA bridgePCI bridgeMicroChannel bridgeEISA bridgeISA bridgeHost bridgeMemory controllerFLASH memoryRAM memoryMultimedia controllerComputer telephony deviceMultimedia audio controllerMultimedia video controllerDisplay controller3D controllerXGA compatible controllerVGA compatible controllerNetwork controllerISDN controllerATM network controllerFDDI network controllerToken ring network controllerEthernet controllerUnknown mass storage controllerRAID bus controllerIPI bus controllerFloppy disk controllerIDE interfaceSCSI storage controllerVGA compatible unclassified deviceNon-VGA unclassified deviceforcenoforce<4>resume warning: bios doesn't restore PCI state properly <4>resume warning: if resume failed, try booting with resume=force PCI Bridge%02x%02x %04x%04x %x %08lx%s%02x%02x.%xPCI devices found: Bus %2d, device %3d, function %2d: %s Class %04x: %s (rev %d). IRQ %d. Master Capable. Latency=%d. No bursts. Min Gnt=%d.Max Lat=%d. I/O at 0x%lx [0x%lx]. unknownPNon-p32 bit20 bit64 bit %srefetchable %s memory at 0x%lx [0x%lx]. pcidevices<3>PCI: Address space collision on region %d of device %s [%lx:%lx] <3>PCI: No parent found for region %d of device %s <3>PCI: Failed to allocate resource %d(%lx-%lx) for %s <4>PCI: Ignore bogus resource %d [%lx:%lx] of %s pdev_sort_resources(): kmalloc() failed! <6>PCI: Bus %d, bridge: %s <6> IO window: %04lx-%04lx <6> IO window: disabled. <6> MEM window: %08lx-%08lx <6> MEM window: disabled. <6> PREFETCH window: %08lx-%08lx <6> PREFETCH window: disabled. <4>PCI: region %s/%d too large: %lx-%lx <5>Probe at base[0x00](0x%08lx) past the end of the map(0x%08lx) <5>Probe at base[0x55](0x%08lx) past the end of the map(0x%08lx) <7>%s: Found an alias at 0x%x for the chip at 0x%lx <4>%s: Too many flash chips detected. Increase MAX_CFI_CHIPS from %d. <6>%s: Found %d x%d devices at 0x%x in %d-bit mode <4>%s: kmalloc failed for CFI ident structure CFIcfi_probecfi_cmdset_0020 ST Microelectronics Extended Query Table at 0x%4.4X <3>Failed to allocate memory <4> Unknown staa Extended Query version %c.%c. <3>Failed to allocate memory for MTD device <3>Failed to allocate memory for MTD erase region info <4>Sum of regions (%lx) != total size of set of interleaved chips (%lx) <7>%d: offset=0x%x,size=0x%x,blocks=%d <3>Chip not ready after erase suspended: status = 0x%x <3>waiting for chip to be ready timed out in read. WSM status = %x <3>waiting for chip to be ready timed out in buffer write Xstatus = %x, status = %x <3>Chip not ready for buffer write. Xstatus = %x <3>waiting for chip to be ready timed out in bufwrite <3>waiting for chip to be ready timed out in erase <3>waiting for erase to complete timed out. Xstatus = %x, status = %x. <4>Status is not identical for all chips: 0x%x. Merging to give 0x%02x <5>Chip reports improper command sequence: status 0x%x <4>Chip reports voltage low on erase: status 0x%x <7>Chip erase failed at 0x%08lx: status 0x%x. Retrying... <7>Chip erase failed at 0x%08lx: status 0x%x <3>waiting for chip to be ready timed out in lock <3>waiting for lock to complete timed out. Xstatus = %x, status = %x. <3>waiting for chip to be ready timed out in unlock <3>waiting for unlock to complete timed out. Xstatus = %x, status = %x. cfi_cmdset_0002<5> Amd/Fujitsu Extended Query Table v%c.%c at 0x%4.4X <4>%s: JEDEC Device ID is 0x%02X. Assuming broken CFI table. <4>%s: Swapping erase regions for broken CFI table. <5>Eep. Unknown cfi_cmdset_0002 device type %d <5>number of %s chips: %d CFIJEDEC<4>Failed to allocate memory for MTD device <4>Failed to allocate memory for MTD erase region info <4>Sum of regions (%lx) != total size of set of interleaved chips (%lx) <4>Unsupported buswidth <5>cfi_cmdset_0002: Disabling fast programming due to code brokenness. <4>Warning: DQ5 raised while program operation was in progress, however operation completed OK <4>Internal flash device timeout occurred or write operation was performed while flash was programming. <4>Waiting for write to complete timed out in do_write_oneword.erase suspended. Sleeping waiting for erase to complete timed out.<7>erase suspended. Sleeping Warning: DQ5 raised while erase operation was in progress, but erase completed OK <4>Internal flash device timeout occured or write operation was performed while flash was erasing Waiting for erase to complete timed out in do_erase_oneblock.<3>Argh. Chip not in PM_SUSPENDED state upon resume() cfi_cmdset_0001<3>Failed to allocate memory <4> Unknown IntelExt Extended Query version %c.%c. <5>cfi_cmdset_0001: Erase suspend on write enabled <3>Failed to allocate memory for MTD device <3>Failed to allocate memory for MTD erase region info <4>Sum of regions (%lx) != total size of set of interleaved chips (%lx) <7>%d: offset=0x%x,size=0x%x,blocks=%d Using buffer write method Using word write method <3>waiting for chip to be ready timed out in read. WSM status = %llx Warning: unpoint called on non pointed region <3>Chip not ready after erase suspended: status = 0x%llx <4>%s: This flash device has no protection data to read! <3>waiting for chip to be ready timed out in read <3>Chip not ready after erase suspended: status = 0x%x <3>waiting for chip to be ready timed out in word write <3>waiting for chip to be ready timed out in buffer write <4>SR.4 or SR.5 bits set in buffer write (status %x). Clearing. <3>Chip not ready for buffer write. Xstatus = %llx, status = %llx <3>waiting for chip to be ready timed out in bufwrite <3>waiting for chip to be ready timed out in erase <3>waiting for erase at %08lx to complete timed out. Xstatus = %llx, status = %llx. <4>Status is not identical for all chips: 0x%llx. Merging to give 0x%02x <5>Chip reports improper command sequence: status 0x%llx <4>Chip reports voltage low on erase: status 0x%llx <7>Chip erase failed at 0x%08lx: status 0x%llx. Retrying... <7>Chip erase failed at 0x%08lx: status 0x%llx <3>%s: waiting for chip to be ready timed out do_xxlock_oneblock<3>waiting for unlock to complete timed out. Xstatus = %llx, status = %llx. <4>gen_probe: No supported Vendor Command Set found <4>%s: Found no %s device at location zero <4>%s: kmalloc failed for CFI private structure <4>genprobe_new_chip called with unsupported buswidth %d cfi_cmdset_%4.4X<5>Support for command set %04X not present A(g?"g @I"g@ f @Cf@ f >f> f ~f~ "xf"`f> "Hf >"0f @I"f@ ["f@ "e @["e@ X"e@ "e @"e @["e @e e xe he Xe He 8e(eee d d dd d d d >d> xd ~hd~ XdHd c> =ccctcOdc Xc"Hc @I"8c@ $cEc @Fb@ bbb?b?b?bbb?b_Qtb[db'XbSST 39LF160SST 49LF080ASST 49LF040ASST 49LF030ASST 39SF020ASST 39SF010ASST 39LF040SST 39LF020SST 29LE020SST 29EE020SST 39LF010SST 39LF512Macronix MX29F004BMacronix MX29F004TMacronix MX29F016MXIC MX29LV160BMXIC MX29LV160TST M29W040BAMD AM29LV040BAMD AM29F040AMD AM29F080AMD AM29F016AMD AM29F017DAtmel AT49BV32XTAtmel AT49BV32XAtmel AT49BV16XTAtmel AT49BV16XAtmel AT29LV512Atmel AT49BV512ST M29W160DBST M29W160DTST M29W800TIntel 82802ACIntel 82802ABIntel 28F640B3TIntel 28F640B3BIntel 28F320B3TIntel 28F320B3BIntel 28F160B3TIntel 28F160B3BIntel 28F016B3TIntel I28F016S3Intel 28F016B3BIntel 28F800B3TIntel 28F800B3BIntel 28F008SAIntel 28F016S5Intel 28F008S5Intel 28F008B3TIntel 28F008B3BIntel 28F400B3TIntel 28F400B3BIntel 28F004B3TIntel 28F004B3BAMD AM29F800BTAMD AM29LV800BTAMD AM29F800BBAMD AM29LV800BBFujitsu MBM29LV800TAFujitsu MBM29LV800BAFujitsu MBM29LV160BEFujitsu MBM29LV160TEFujitsu MBM29LV320BEFujitsu MBM29LV320TEFujitsu MBM29LV650UEToshiba TC58FVT641Toshiba TC58FVB641Toshiba TC58FVT321Toshiba TC58FVB321Toshiba TC58FVB160Toshiba TC58FVT160AMD AM29LV160DBAMD AM29LV160DTAMD AM29F032BFound: %s <5>Eep. Unknown jedec_probe device type %d <5>Probe at base(0x%08x) past the end of the map(0x%08lx) <5>Probe at addr_unlock1(0x%08x + 0x%08x) past the end of the map(0x%08lx) <5>Probe at addr_unlock2(0x%08x + 0x%08x) past the end of the map(0x%08lx) <6>Search for id:(%02x %02x) interleave(%d) type(%d) <7>%s: Found different chip or no chip at all (mfr 0x%x, id 0x%x) at 0x%x <7>%s: Found an alias at 0x%x for the chip at 0x%lx <4>%s: Too many flash chips detected. Increase MAX_CFI_CHIPS from %d. <6>%s: Found %d x%d devices at 0x%x in %d-bit mode JEDECjedec_probeDC21285 flashnone<3>DC21285 flash: undefined buswidth <5>DC21285 flash support (%d-bit buswidth) Failed to ioremap cfi_probejedec_probe<5>DC21285 Flash: no partition info available, registering whole flash at once mtd%d: %8.8x %8.8x "%s" dev: size erasesize name mtdkmalloc is null %d%dromtd<5>Can't allocate major number %d for Memory Technology Devices. dummy deviceMMpMpMpMpMpMpMpMpMpMpMpMpMegaEGA+mda*MDAEGAvga+VGA+cga*CGA@zMPN4c4c4cP`4cR X]S^_`NOVGA8x16vga16clgencyber2000%d %s fb%dWarning: Remapping obsolete /dev/fb* minor %d to %d %dfbunable to get major %d for fb devs scrollback:map:vc:offframe buffer device<3>fbcon_setup: No support for fontwidth %d <4>fbcon_setup: type %d (aux %d, depth %d) not supported fbcon_redraw_bmove width sy != dyHGAз Acorn8x8 <4>%s: no support for %dbpp <3>disable_extregs: count = 0 ,font:<3>CyberPro20x0: unknown parameter: %s %s: no valid mode found <6>%s: %dKiB VRAM, using %dx%d, %d.%03dkHz, %dHz <6>%s: enabling PCI bursts CyberPro%4X<4>%s: danger Will Robinson, danger danger! Oopsen imminent! CyberProCL SD64CL PiccoloCL PicassoCL SpectrumCL Picasso4CL AlpineCL GD5480CL Lagunao" o_"$o_ !"0o_"clgen: ERROR: Frequency greater than maxclock (%ld kHz) <4>clgen: ERROR: VerticalTotal >= 1280; special treatment required! (TODO) fb_info != NULLclgen_set_mclk<4>clgen: unknown Board <4>CLGEN: unknown Board <3>clgen: What's this?? requested color depth == %d. regno < 16clgen_setcolreginit_vgachip<3>clgen: Warning: Unknown board type fb_info->size > 0<6>clgen: This board has %ld bytes of DRAM memory _par != NULLclgen_set_dispCirrus Logic video mode: monochrome 8 bit color depth 16 bit color depth 24 bit color depth 32 bit color depth unsupported color depth CLgenfb: Unknown memory size! pdev != NULLget_pci_addrsdisplay != NULLregisters != NULL*display != 0<6>clgenfb: couldn't find Cirrus Logic PCI device clgenfb<3>clgen: cannot reserve region 0x%lx, abort RAM (%lu kB) at 0x%lx, Cirrus Logic chipset on PCI bus <6>clgen: Driver for Cirrus Logic based graphic boards, v1.9.9.1 btype != BT_NONEclgenfb_initbtype == clgen_board_info[btype].btypeclgen: disabling text acceleration support <3>clgen: ERROR - could not register fb device; err = %d! Framebuffer unregistered ,mode:%snoaccelAttrOnbest != NULLbestclocknom != NULLden != NULLmaxfreq > 0VGA16 VGA,font:<7>vga16fb: initializing <3>vga16fb: unable to map device <6>vga16fb: mapped to 0x%p <6>fb%d: %s frame buffer device BUG: dst underflow %d: %p socket:wsockfs[%lu]<3>socki_lookup: socket file changed! <3>sock_release: fasync list not empty! <7>sock_close: NULL inode <6>%s uses obsolete (PF_INET,SOCK_PACKET) net-pf-%d<4>socket: no more sockets <2>protocol %d >= NPROTO(%d) <6>Linux NET4.0 for Linux 2.4 <6>Based upon Swansea University Computer Society NET3.039 sockets: used %d BUG: dst underflow %d: %p <7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value <7>sk_free: optmem leakage (%d bytes) detected. sock<2>sk_init: Cannot create sock SLAB cache!BUG: dst underflow %d: %p skput:over: %p:%d put:%d dev:%sskput:under: %p:%d put:%d dev:%s<3>alloc_skb called nonatomically from interrupt %p <4>Warning: kfree_skb passed an skb still on a list (from %p). <4>Warning: kfree_skb on hard IRQ %p KERNEL: assertion (start <= offset+len) failed at skbuff.c(%d) skbuff_head_cachecannot create skbuff cacheBUG: dst underflow %d: %p BUG: dst underflow %d: %p KERNEL: assertion (start <= offset+len) failed at datagram.c(%d) BUG: dst underflow %d: %p somaxconnhot_list_lengthoptmem_maxmessage_burstmessage_costmod_conglo_congno_congno_cong_threshnetdev_max_backlogdev_weightrmem_defaultwmem_defaultrmem_maxwmem_maxBUG: dst underflow %d: %p flow_cacheNET: failed to allocate flow cache slab Failed to allocate flow cache hash table BUG: dst underflow %d: %p 100baseFX100baseTX100baseTAUI10baseTBNCunknown<4>dev_remove_pack: %p not found. RTNL: assertion failed at dev.c(%d) <7>%s: default_rebuild_header called -- BUG! NULL!!!<2>protocol %04x is buggy, dev %s <2>Virtual device %s asks to queue packet! <2>Dead loop on virtual device %s, fix it urgently! KERNEL: assertion (atomic_read(&skb->users) == 0) failed at dev.c(%d) %6s:%8lu %7lu %4lu %4lu %4lu %5lu %10lu %9lu %8lu %7lu %4lu %4lu %4lu %5lu %7lu %10lu %6s: No statistics available. Inter-| Receive | Transmit face |bytes packets errs drop fifo frame compressed multicast|bytes packets errs drop fifo colls carrier compressed %08x %08x %08x %08x %08x %08x %08x %08x %08x <6>device %s %s promiscuous mode enteredleft%s: Dropping NETIF_F_SG since no checksum feature. registerKERNEL: assertion (dev->ip_ptr==NULL) failed at dev.c(%d) KERNEL: assertion (dev->ip6_ptr==NULL) failed at dev.c(%d) KERNEL: assertion (dev->dn_ptr==NULL) failed at dev.c(%d) <3>Freeing alive device %p, %s KERNEL: assertion (dev->deadbeaf==0) failed at dev.c(%d) <7>unregister_netdevice: device %s/%p never was registered unregisterKERNEL: assertion (dev->master==NULL) failed at dev.c(%d) <0>unregister_netdevice: waiting for %s to become free. Usage count = %d devnet/softnet_statnet/driverswirelessINTERFACE=%sACTION=%snetHOME=/PATH=/sbin:/bin:/usr/sbin:/usr/bin BUG: dst underflow %d: %p dev_mc_discard: multicast leakage! dmi_users=%d %-4d %-15s %-5d %-5d %02x net/dev_mcastBUG: dst underflow %d: %p BUG: dst underflow %d: %p Destroying alive neighbour %p Impossible event. neigh: timer & !nud_in_timer neigh_resolve_output: dst=%p neigh=%p neigh_parms_release: not found <2>neighbour leakage netneighdefaultgc_thresh3gc_thresh2gc_thresh1gc_intervallocktimeproxy_delayanycast_delayproxy_qlenunres_qlengc_stale_timedelay_first_probe_timebase_reachable_timeretrans_timeapp_solicitucast_solicitmcast_solicitBUG: dst underflow %d: %p $$$   Initializing RT netlink socket rtnetlink_init: cannot initialize rtnetlink <4>NET: %d messages suppressed. BUG: dst underflow %d: %p <3>OOM queueing packet %p    4@ !!!!    .   %6s: %04x %3d%c %3d%c %3d%c %6d %6d %6d %6d %6d %6d Inter-| sta-| Quality | Discarded packets | Missed | WE face | tus | link level noise | nwid crypt frag retry misc | beacon | %d <3>%s (WE) : Buffer for request SIOCGIWPRIV too small (%d<%d) <3>%s (WE) : Buffer for request %04X too small (%d<%d) <3>%s (WE) : Invalid/Unknown Wireless Event (0x%04X) <3>%s (WE) : Wireless Event too big (%d) <3>%s (WE) : Wireless Event too small (%d) BUG: dst underflow %d: %p <7>%s: unable to resolve type %X addresses. EtherII802.3rif_timeout802.2SNAP - unable to register with 802.2 SNAPtr_rebuild_header: Don't know how to resolve type %04X addresses ? <7>tr.c: Couldn't malloc rif cache entry ! if TR address TTL rcf routing segments %s %02X:%02X:%02X:%02X:%02X:%02X %7li ?local %04X %03X-%01X-%03X tr_riffc_rebuild_header: Don't know how to resolve type %04X addresses ? BUG: dst underflow %d: %p %s: Don't know how to resolve type %02X addresses. BUG: dst underflow %d: %p hippi_header(): length not supplied <7>%s: unable to resolve type %X addresses. BUG: dst underflow %d: %p <7>Dead loop on netdevice %s, fix it urgently! <6>NETDEV WATCHDOG: %s: transmit timed out <7>%s deferred output. It is buggy. <6>%s: activation failed KERNEL: assertion (dev->qdisc_list == NULL) failed at sch_generic.c(%d) KERNEL: assertion (!timer_pending(&dev->watchdog_timer)) failed at sch_generic.c(%d) BUG: dst underflow %d: %p sch_%s%08x %08x %08x %08x net/pschedBUG: dst underflow %d: %p BUG: dst underflow %d: %p BUG: dst underflow %d: %p cls_%sBUG: dst underflow %d: %p Freeing alive netlink socket %p KERNEL: assertion (atomic_read(&sk->rmem_alloc)==0) failed at af_netlink.c(%d) KERNEL: assertion (atomic_read(&sk->wmem_alloc)==0) failed at af_netlink.c(%d) KERNEL: assertion (sk->protinfo.af_netlink->cb==NULL) failed at af_netlink.c(%d) sk Eth Pid Groups Rmem Wmem Dump Locks %p %-3d %-6d %08x %-8d %-8d %p %d<2>netlink_init: panic net/netlinkBUG: dst underflow %d: %p <7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value %-127s Iface Destination Gateway Flags RefCnt Use Metric Source MTU Window IRTT TOS HHRef HHUptod SpecDst%s %08lX %08lX %8X %d %u %d %08lX %d %u %u %02X %d %1d %08X*%08x %08x %08x %08x %08x %08x %08x %08x %08x %08x %08x %08x %08x %08x %08x %08x %08x <4>dst cache overflow <4>Neighbour table overflow. <7>rt_bind_peer(0) @%p <7>ip_rt_bug: %u.%u.%u.%u -> %u.%u.%u.%u, %s ?<2>Bug in ip_route_input_slow(). Please, report secret_intervalmin_adv_mssmin_pmtumtu_expiresgc_elasticityerror_bursterror_costredirect_silenceredirect_numberredirect_loadgc_intervalgc_timeoutgc_min_intervalmax_sizegc_threshmax_delaymin_delayflushIP: failed to allocate ip_rt_acct ip_dst_cacheIP: failed to allocate ip_dst_cache Failed to allocate IP route cache hash table <6>IP: routing cache hash table of %u buckets, %ldKbytes rt_cachert_cache_statnet/rt_acctinet_peer_cacheBUG: dst underflow %d: %p <7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value TCP: inuse %d orphan %d tw %d alloc %d mem %d UDP: inuse %d RAW: inuse %d FRAG: inuse %d memory %d Ip: Forwarding DefaultTTL InReceives InHdrErrors InAddrErrors ForwDatagrams InUnknownProtos InDiscards InDelivers OutRequests OutDiscards OutNoRoutes ReasmTimeout ReasmReqds ReasmOKs ReasmFails FragOKs FragFails FragCreates Ip: %d %d %lu Icmp: InMsgs InErrors InDestUnreachs InTimeExcds InParmProbs InSrcQuenchs InRedirects InEchos InEchoReps InTimestamps InTimestampReps InAddrMasks InAddrMaskReps OutMsgs OutErrors OutDestUnreachs OutTimeExcds OutParmProbs OutSrcQuenchs OutRedirects OutEchos OutEchoReps OutTimestamps OutTimestampReps OutAddrMasks OutAddrMaskReps Icmp: Tcp: RtoAlgorithm RtoMin RtoMax MaxConn ActiveOpens PassiveOpens AttemptFails EstabResets CurrEstab InSegs OutSegs RetransSegs InErrs OutRsts Tcp: %ld Udp: InDatagrams NoPorts InErrors OutDatagrams Udp: TcpExt: SyncookiesSent SyncookiesRecv SyncookiesFailed EmbryonicRsts PruneCalled RcvPruned OfoPruned OutOfWindowIcmps LockDroppedIcmps ArpFilter TW TWRecycled TWKilled PAWSPassive PAWSActive PAWSEstab DelayedACKs DelayedACKLocked DelayedACKLost ListenOverflows ListenDrops TCPPrequeued TCPDirectCopyFromBacklog TCPDirectCopyFromPrequeue TCPPrequeueDropped TCPHPHits TCPHPHitsToUser TCPPureAcks TCPHPAcks TCPRenoRecovery TCPSackRecovery TCPSACKReneging TCPFACKReorder TCPSACKReorder TCPRenoReorder TCPTSReorder TCPFullUndo TCPPartialUndo TCPDSACKUndo TCPLossUndo TCPLoss TCPLostRetransmit TCPRenoFailures TCPSackFailures TCPLossFailures TCPFastRetrans TCPForwardRetrans TCPSlowStartRetrans TCPTimeouts TCPRenoRecoveryFail TCPSackRecoveryFail TCPSchedulerFailed TCPRcvCollapsed TCPDSACKOldSent TCPDSACKOfoSent TCPDSACKRecv TCPDSACKOfoRecv TCPAbortOnSyn TCPAbortOnData TCPAbortOnClose TCPAbortOnMemory TCPAbortOnTimeout TCPAbortOnLinger TCPAbortFailed TCPMemoryPressures TcpExt:BUG: dst underflow %d: %p <7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value BUG: dst underflow %d: %p <6>source route option %u.%u.%u.%u -> %u.%u.%u.%u BUG: dst underflow %d: %p KERNEL: assertion (qp->last_in&COMPLETE) failed at ip_fragment.c(%d) KERNEL: assertion (del_timer(&qp->timer) == 0) failed at ip_fragment.c(%d) <3>ip_frag_create: no memory left ! KERNEL: assertion (head != NULL) failed at ip_fragment.c(%d) KERNEL: assertion (FRAG_CB(head)->offset == 0) failed at ip_fragment.c(%d) <3>IP: queue_glue: no memory for gluing queue %p <6>Oversized IP packet from %d.%d.%d.%d. BUG: dst underflow %d: %p <7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value BUG: dst underflow %d: %p <2>ip_forward(): Argh! Destination lost! BUG: dst underflow %d: %p <7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value KERNEL: assertion (newskb->dst) failed at ip_output.c(%d) <7>ip_finish_output2: No header cache and no neighbour! <6>IP: frag: no memory for new fragment! KERNEL: assertion (copy == 0) failed at ip_output.c(%d) KERNEL: assertion (len == 0) failed at ip_output.c(%d) igmpmcfilterBUG: dst underflow %d: %p <7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value BUG: dst underflow %d: %p <7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value KERNEL: assertion (lopt->qlen == 0) failed at tcp.c(%d) KERNEL: assertion (child->lock.users==0) failed at tcp.c(%d) KERNEL: assertion (sk->ack_backlog == 0) failed at tcp.c(%d) KERNEL: assertion (skb==NULL || before(tp->copied_seq, TCP_SKB_CB(skb)->end_seq)) failed at tcp.c(%d) <6>recvmsg bug: copied %X seq %X KERNEL: assertion (flags&MSG_PEEK) failed at tcp.c(%d) KERNEL: assertion (tp->copied_seq == tp->rcv_nxt || (flags&(MSG_PEEK|MSG_TRUNC))) failed at tcp.c(%d) <7>TCP(%s:%d): Application bug, race in MSG_PEEK. KERNEL: assertion (skb_queue_empty(&sk->write_queue)) failed at tcp.c(%d) KERNEL: assertion (sk->wmem_queued == 0) failed at tcp.c(%d) KERNEL: assertion (sk->forward_alloc == 0) failed at tcp.c(%d) KERNEL: assertion (sk->state==TCP_CLOSE) failed at tcp.c(%d) KERNEL: assertion (sk->dead) failed at tcp.c(%d) KERNEL: assertion (sk->pprev==NULL) failed at tcp.c(%d) KERNEL: assertion (!sk->num || sk->prev!=NULL) failed at tcp.c(%d) <7>TCP: double destroy sk=%p KERNEL: assertion (sk->lock.users==0) failed at tcp.c(%d) <6>TCP: too many of orphaned sockets KERNEL: assertion (!sk->num || sk->prev) failed at tcp.c(%d) KERNEL: assertion (newsk->state != TCP_SYN_RECV) failed at tcp.c(%d) tcp_open_requesttcp_init: Cannot alloc open_request cache.tcp_bind_buckettcp_init: Cannot alloc tcp_bind_bucket cache.tcp_tw_buckettcp_init: Cannot alloc tcp_tw_bucket cache.Failed to allocate TCP established hash table Failed to allocate TCP bind hash table <6>TCP: Hash tables configured (established %d bind %d) BUG: dst underflow %d: %p <7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value KERNEL: assertion ((int)tp->sacked_out >= 0) failed at tcp_input.c(%d) KERNEL: assertion ((int)tp->lost_out >= 0) failed at tcp_input.c(%d) KERNEL: assertion ((int)tp->retrans_out >= 0) failed at tcp_input.c(%d) KERNEL: assertion ((int)tcp_packets_in_flight(tp) >= 0) failed at tcp_input.c(%d) KERNEL: assertion (cnt <= tp->packets_out) failed at tcp_input.c(%d) KERNEL: assertion (tp->retrans_out == 0) failed at tcp_input.c(%d) <7>Leak l=%u %d <7>Leak s=%u %d <7>Leak r=%u %d <7>Ack %u out of %u:%u tcp_parse_options: Illegal window scaling value %d >14 received.tcp_fin: Impossible, sk->state=%d KERNEL: assertion (!before(tp->rcv_nxt, sp->end_seq)) failed at tcp_input.c(%d) <7>ofo packet was already received <7>ofo requeuing : rcv_next %X seq %X - %X <7>partial packet: rcv_next %X seq %X - %X <7>out of order segment: rcv_next %X seq %X - %X <7>prune_queue: c=%x BUG: dst underflow %d: %p <7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value <7>retrans_out leaked. <7>tcp_send_synack: wrong queue state BUG: dst underflow %d: %p <7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value <7>tcpbug: unknown timer value <6>Out of socket memory KERNEL: assertion (!skb_queue_empty(&sk->write_queue)) failed at tcp_timer.c(%d) <7>TCP: Treason uncloaked! Peer %u.%u.%u.%u:%u/%u shrinks window %u:%u. Repaired. BUG: dst underflow %d: %p <7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value KERNEL: assertion (sk->prev == (struct sock *) tb) failed at tcp_ipv4.c(%d) KERNEL: assertion (sk->pprev==NULL) failed at tcp_ipv4.c(%d) KERNEL: assertion (tb->owners != NULL) failed at tcp_ipv4.c(%d) KERNEL: assertion (req->sk == NULL) failed at tcp_ipv4.c(%d) <6>possible SYN flooding on port %d. Sending cookies. <7>TCP: drop open request from %u.%u.%u.%u/%u <7>hw tcp v4 csum failed <6>tcp_v4_rebuild_header(): shifting sk->saddr from %d.%d.%d.%d to %d.%d.%d.%d %4d: %08X:%04X %08X:%04X %02X %08X:%08X %02X:%08X %08X %5d %8d %u %d %p%4d: %08X:%04X %08X:%04X %02X %08X:%08X %02X:%08lX %08X %5d %8d %lu %d %p %u %u %u %u %d%4d: %08X:%04X %08X:%04X %02X %08X:%08X %02X:%08X %08X %5d %8d %d %d %p%-*s sl local_address rem_address st tx_queue rx_queue tr tm->when retrnsmt uid timeout inodeFailed to create the TCP control socket. BUG: dst underflow %d: %p <7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value KERNEL: assertion (sk->prev!=NULL) failed at tcp_minisocks.c(%d) <6>TCP: time wait bucket table overflow BUG: dst underflow %d: %p <7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value tcpdiag_init: Cannot create netlink socket.BUG: dst underflow %d: %p <6>%s forgot to set AF_INET in raw sendmsg. Fix it! %4d: %08X:%04X %08X:%04X %02X %08X:%08X %02X:%08lX %08X %5d %8d %lu %d %p%-127s sl local_address rem_address st tx_queue rx_queue tr tm->when retrnsmt uid timeout inodeBUG: dst underflow %d: %p <7>udp cork app bug 2 <7>udp cork app bug 3 <6>udp_encap_rcv(): Unhandled UDP encap type: %u <7>udp v4 hw csum failure. <7>UDP: short packet: %u.%u.%u.%u:%u %d/%d to %u.%u.%u.%u:%u <7>UDP: bad checksum. From %d.%d.%d.%d:%d to %d.%d.%d.%d:%d ulen %d %4d: %08X:%04X %08X:%04X %02X %08X:%08X %02X:%08lX %08X %5d %8d %lu %d %p%-127s sl local_address rem_address st tx_queue rx_queue tr tm->when retrnsmt uid timeout inodeBUG: dst underflow %d: %p <7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value arp_cache<7>trying to ucast probe in NUD_INVALID <7>ARP: arp called for own IP address <7>arp_find is called with dst==NULL 0123456789ABCDEFIP address HW type Flags HW address Mask Device %u.%u.%u.%u%-16s 0x%-10x0x%-10x%s * %s 00:00:00:00:00:00*arpipv4BUG: dst underflow %d: %p <7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value <6>ICMP: %u.%u.%u.%u: fragmentation needed and DF set. <6>ICMP: %u.%u.%u.%u: Source Route Failed. <4>%u.%u.%u.%u sent an invalid ICMP type %u, code %u error to a broadcast: %u.%u.%u.%u on %s <6>Wrong address mask %u.%u.%u.%u from %s/%u.%u.%u.%u <7>icmp v4 hw csum failure Failed to create the ICMP control socket. BUG: dst underflow %d: %p KERNEL: assertion (idev->ifa_list==NULL) failed at devinet.c(%d) KERNEL: assertion (idev->mc_list==NULL) failed at devinet.c(%d) Freeing alive in_device %p RTNL: assertion failed at devinet.c(%d) ipv4KERNEL: assertion (ifa->ifa_dev==NULL) failed at devinet.c(%d) :%d<7>inetdev_event: bug netconfallforce_igmp_versiondisable_policydisable_xfrmarp_ignorearp_announcearp_filtertaglog_martiansbootp_relaymedium_idproxy_arpaccept_source_routesend_redirectsrp_filtershared_mediasecure_redirectsaccept_redirectsmc_forwardingforwardingdefaultBUG: dst underflow %d: %p <7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value Attempt to release TCP socket in state %d %p Attempt to release alive inet socket %p KERNEL: assertion (atomic_read(&sk->rmem_alloc) == 0) failed at af_inet.c(%d) KERNEL: assertion (atomic_read(&sk->wmem_alloc) == 0) failed at af_inet.c(%d) KERNEL: assertion (sk->wmem_queued == 0) failed at af_inet.c(%d) KERNEL: assertion (sk->forward_alloc == 0) failed at af_inet.c(%d) KERNEL: assertion ((1<state)&(TCPF_ESTABLISHED|TCPF_CLOSE_WAIT|TCPF_CLOSE)) failed at af_inet.c(%d) bridge8021qdlci<3>Attempt to override permanent protocol %d. <3>Ignoring attempt to register illegal socket type %d. <3>Attempt to unregister permanent protocol %d. <6>NET4: Linux TCP/IP 1.0 for NET4.0 <2>inet_proto_init: panic <2>inet_init: Cannot add ICMP protocol <2>inet_init: Cannot add UDP protocol <2>inet_init: Cannot add TCP protocol <2>inet_init: Cannot add IGMP protocol rawnetstatsnmpsockstattcpudpBUG: dst underflow %d: %p <7>New IGMP type=%d, why we do not know about it? RTNL: assertion failed at igmp.c(%d) Idx Device : Count Querier Group Users Timer Reporter NONEV2V3V1%d %-10s: %5d %7s %08lX %5d %d:%08lX %d %3s %6s %10s %10s %6s %6s IdxDeviceMCASRCINCEXC%3d %6.6s 0x%08x 0x%08x %6lu %6lu BUG: dst underflow %d: %p <7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value tcp_moderate_rcvbuftcp_default_win_scaletcp_bic_low_windowtcp_bic_fast_convergencetcp_bictcp_vegas_gammatcp_vegas_betatcp_vegas_alphatcp_vegas_cong_avoidtcp_no_metrics_savetcp_westwoodipfrag_secret_intervaltcp_low_latencytcp_frtotcp_tw_reuseicmp_ratemaskicmp_ratelimittcp_adv_win_scaletcp_app_wintcp_rmemtcp_wmemtcp_memtcp_dsacktcp_ecntcp_reorderingtcp_facktcp_orphan_retriesinet_peer_gc_maxtimeinet_peer_gc_mintimeinet_peer_maxttlinet_peer_minttlinet_peer_thresholdigmp_max_msfigmp_max_membershipsrouteicmp_ignore_bogus_error_responsesicmp_echo_ignore_broadcastsicmp_echo_ignore_allip_local_port_rangetcp_max_syn_backlogtcp_rfc1337tcp_stdurgtcp_abort_on_overflowtcp_tw_recycletcp_syncookiestcp_fin_timeouttcp_retries2tcp_retries1tcp_keepalive_intvltcp_keepalive_probestcp_keepalive_timeipfrag_timeip_dynaddripfrag_low_threshipfrag_high_threshtcp_max_tw_bucketstcp_max_orphanstcp_synack_retriestcp_syn_retriesip_nonlocal_bindip_no_pmtu_discip_autoconfigip_default_ttlip_forwardtcp_retrans_collapsetcp_sacktcp_window_scalingtcp_timestampsBUG: dst underflow %d: %p <7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value %-127s Iface Destination Gateway Flags RefCnt Use Metric Mask MTU Window IRTT<7>fib_add_ifaddr: bug: prim == NULL <7>fib_del_ifaddr: bug: prim == NULL routeBUG: dst underflow %d: %p <7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value Freeing alive fib_info %p <7>impossible 102 %s %08X %08X %04X %d %u %d %08X %d %u %u** %08X %08X %04X %d %u %d %08X %d %u %uBUG: dst underflow %d: %p <7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value <2>route.c: bad divisor %d! ip_fib_hashBUG: dst underflow %d: %p <7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value ?BUG: dst underflow %d: %p BUG: dst underflow %d: %p BUG: dst underflow %d: %p BUG: dst underflow %d: %p IPIP<6>ipip init: can't add xfrm type <6>ipip init: can't add protocol <6>ipip close: can't remove protocol <6>ipip close: can't remove xfrm type BUG: dst underflow %d: %p xfrm-type-%d-%dxfrm_dst_cacheXFRM: failed to allocate xfrm_dst_cache BUG: dst underflow %d: %p KERNEL: assertion (x->km.state == XFRM_STATE_DEAD) failed at xfrm_state.c(%d) BUG: dst underflow %d: %p secpath_cacheXFRM: failed to allocate secpath_cache BUG: dst underflow %d: %p digest_nullmd5sha1sha256ripemd160cipher_nulldesdes3_edecast128blowfishaesserpenttwofishdeflatelzslzjhKERNEL: assertion (start <= offset + len) failed at xfrm_algo.c(%d) BUG: dst underflow %d: %p BUG: dst underflow %d: %p BUG: dst underflow %d: %p <2>Unable to register AARP with SNAP. %-10.10s %-10.10s%-18.18s%12.12s%12.12s xmit_count status addressdevicehw addrlast_sentexpires%6u:%-3u %-10.10s%2.2X:%2.2X:%2.2X:%2.2X:%2.2X:%2.2X%12lu %12lu %10u resolved unresolved proxy aarpBUG: dst underflow %d: %p Type local_addr remote_addr tx_queue rx_queue st uid %02X %04X:%02X:%02X %08X:%08X %02X %d <7>AppleTalk: point-to-point interface added with existing address <4>Too many routes/iface. Interface Address Networks Status %-16s %04X:%02X %04X-%04X %d Target Router Flags Dev Default %04X:%02X %-4d %s %04X:%02X %04X:%02X %-4d %s <4>%s is broken and did not set SO_BROADCAST. It will break when 2.2 is released. <7>AppleTalk: didn't forward broadcast packet received from PPP iface <6>SO_BROADCAST: Fix your netatalk as it will break before 2.2 <7>SK %p: Got address. <7>SK %p: Size needed %d, device %s <7>SK %p: Begin build. <7>SK %p: Copy user data (%d bytes). <7>SK %p: send out(copy). <7>SK %p: Loop back. <7>SK %p: send out. <7>SK %p: Done write (%d). <2>Unable to register DDP with SNAP. appletalkatalk_routeatalk_iface<6>NET4: AppleTalk 0.18a for Linux NET4.0 aarp-resolve-timeaarp-retransmit-limitaarp-tick-timeaarp-expiry-timeappletalknetunknownRPC: creating %s client for %s (xprt %p) bindwait<6>RPC: out of memory in rpc_create_client <6>RPC: Couldn't create auth handle (flavor %d) RPC: shutting down %s client for %s RPC: rpc_shutdown_client: client %s, tasks=%d RPC: destroying %s client for %s RPC: rpc_release_client(%p, %d) rpc_call_sync: Illegal flag combination for synchronous task <3>%s (vers %d): bad procedure number %d RPC: %4d call_start %s%d proc %d (%s) asyncsyncRPC: %4d call_reserve RPC: %4d call_reserveresult (status %d) <3>%s: status=%d, but no request slot, exiting call_reserveresult<3>%s: status=%d, request allocated anyway <3>%s: unrecognized error %d, exiting RPC: %4d call_allocate (status %d) <6>RPC: buffer allocation failed for task %p RPC: %4d call_encode (status %d) <6>RPC: call_header failed, exit EIO <4>%s: can't encode arguments: %d RPC: %4d call_bind xprt %p %s connected isis notRPC: %4d call_connect status %d RPC: %4d call_transmit (status %d) RPC: %4d call_status (status %d) %s: RPC call returned error %d RPC: %4d call_timeout (minor) RPC: %4d call_timeout (major) <5>%s: server %s not responding, timed out <5>%s: server %s not responding, still trying RPC: %4d call_decode (status %d) <5>%s: server %s OK <4>%s: too small RPC reply size (%d bytes) <4>%s: receive buffer is inconsistent. Please contact maintainer. call_decodeRPC: %4d retry squashed uid RPC: %4d call_decode result %d RPC: %4d call_refresh RPC: %4d call_refreshresult (status %d) <4>call_verify: not an RPC reply: %x <4>call_verify: RPC call rejected: %x RPC: %4d call_verify: retry stale creds RPC: %4d call_verify: retry garbled creds <5>call_verify: server requires stronger authentication. <4>call_verify: unknown auth error: %x RPC: %4d call_verify: call rejected %d <4>call_verify: auth check failed <4>RPC: call_verify: program %u is unsupported by server %s <4>RPC: call_verify: program %u, version %u unsupported by server %s <4>RPC: call_verify: proc %u unsupported by program %u, version %u on server %s <4>call_verify: server accept status: %x RPC: %4d call_verify: server saw garbage <4>RPC: garbage, retrying %4d <4>RPC: garbage, exit EIO unknownBUG: dst underflow %d: %p <7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value RPC: %4d TCP write queue full packet data:RPC: xprt_sendmsg(%d) = %d <5>RPC: sendmsg returned error %d RPC: %4d xprt_cwnd_limited cong = %ld cwnd = %ld RPC: cong %ld, cwnd was %ld, now %ld <4>xprt_adjust_timeout: to_current = 0! RPC: disconnected transport %p RPC: %4d xprt_connect %p connected %d RPC: %4d connecting new socket RPC: %4d connect status %d connected %d RPC: %4d waiting for connection <4>RPC: error %d connecting to server %s, exiting <4>RPC: error %d connecting to server %s RPC: %4d xprt_connect_status: connection established RPC: %4d xprt_connect_status: timed out <3>RPC: error %d connecting to server %s RPC: %4d has input (%d bytes) RPC: udp_data_ready... RPC: udp_data_ready request not found! RPC: udp_data_ready client %p RPC: impossible RPC reply size %d! RPC: %4d received reply <3>RPC: Invalid TCP record fragment length RPC: reading TCP record fragment of length %d RPC: reading XID (%Zu bytes) RPC: reading reply for XID %08x RPC: XID %08x request not found! RPC: %4d received reply complete RPC: tcp_data_recv RPC: tcp_data_recv done RPC: tcp_data_ready... RPC: tcp_data_ready socket info not found! RPC: tcp_state_change client %p... RPC: state %x conn %d dead %d zapped %d RPC: %4d xprt_timer (%s request) pendingbackloggedRPC: %4d xprt_transmit(%x) RPC: %4d xmit incomplete (%d left of %d) RPC: %4d xmit complete RPC: waiting for request slot RPC: %4d reserved req %p xid %08x RPC: %4d release request %p RPC: setting up %s transport... UDPTCPxprt_pendingxprt_sendingxprt_resendxprt_backlogRPC: created transport %p RPC: Can't bind to reserved port (%d). RPC: xprt_create_socket(%s %d) udptcpRPC: can't create socket (%d). RPC: xprt_create_proto created xprt %p RPC: xprt_create_proto failed RPC: destroying transport %p unknownschedqchildqdelayqRPC: %4d disabling timer RPC: %4d running timer RPC: %4d setting alarm for %lu ms RPC: %4d deleting timer <4>RPC: doubly enqueued task! RPC: %4d added to queue %p "%s" RPC: %4d removed from queue %p "%s" <3>RPC: task w/ running timer in rpc_make_runnable!! <4>RPC: failed to add task to queue: error: %d! <3>rpciod: wot no daemon? RPC: %4d sleep_on(queue "%s" time %ld) <3>RPC: Inactive synchronous task put to sleep! <3>RPC: %4d overwrites an active callback RPC: %4d __rpc_wake_up_task (now %ld inh %d) <3>RPC: attempt to wake up non-existing task! <3>RPC: Inactive task (%p) being woken up! RPC: __rpc_wake_up_task done RPC: %d timeout (default timer) RPC: wake_up_next(%p "%s") RPC: %4d rpc_execute flgs %x <4>RPC: rpc_execute called for sleeping task!! RPC: %4d sync task going to sleep <3>RPC: rpciod waiting on sync task! RPC: %4d sync task resuming RPC: %4d got signal <3>RPC: dead task tries to walk away. RPC: %4d exit() = %d <6>RPC: execution inhibited! <3>RPC: active task was run twice! RPC: rpc_schedule enter RPC: rpc_schedule leave RPC: allocated buffer %p RPC: used last-ditch swap buffer RPC: %4d new task procpid %d RPC: %4d freeing task RPC: %4d allocated task rpc_new_task: failed, users=%d, oneshot=%d RPC: %4d release task <3>RPC: attempt to release a non-existing task! RPC: killing all tasks for client %p rpciodRPC: rpciod starting (pid %d) RPC: rpciod back to sleep RPC: switch to rpciod RPC: rpciod shutdown commences <3>rpciod: active tasks at shutdown?! RPC: rpciod exiting rpciod_killall: waiting for tasks to exit rpciod_up: pid %d, users %d <4>rpciod_up: no pid, %d users?? <4>rpciod_up: create thread failed, error=%d rpciod_down pid %d sema %d <4>rpciod_down: pid=%d, no users?? rpciod_down: Nothing to do! rpciod_down: waiting for pid %d to exit rpciod_down: caught signal -pid- proc flgs status -client- -prog- --rqstp- -timeout -rpcwait -action- --exit-- %05d %04d %04x %06d %8p %6d %8p %08ld %8s %8p %8p unknownRPC: gc'ing RPC credentials for auth %p RPC: looking up %s cred RPC: %4d looking up %s cred RPC: matching %s cred %d RPC: %4d holding %s cred %p RPC: %4d releasing %s cred %p RPC: %4d marshaling %s cred %p RPC: %4d validating %s cred %p RPC: %4d refreshing %s cred %p RPC: %4d invalidating %s cred %p unknownRPC: creating NULL authenticator for client %p RPC: destroying NULL authenticator %p RPC: bad verf flavor: %ld RPC: bad verf size: %ld NULLunknownRPC: creating UNIX authenticator for client %p RPC: destroying UNIX authenticator %p RPC: allocating UNIX cred for uid %d gid %d RPC: allocating fake UNIX cred for uid %d gid %d RPC: bad verf flavor: %ld RPC: giant verf size: %ld UNIXunknownRPC: svc_destroy(%s, %d) svc_destroy: no threads for serv=%p! RPC: svc_register(%s, %s, %d) udptcpsvc: failed to encode reply svc: calling dispatcher svc: svc_process dropit svc: short len %d, dropping request svc: bad direction %d, dropping request svc: authentication failed (%d) svc: unknown program %d (me %d) svc: unknown version (%d) svc: unknown procedure (%d) svc: failed to decode args BUG: dst underflow %d: %p svc: service %p, releasing skb %p <3>svc_sock_enqueue: threads and sockets both waiting?? svc: socket %p busy, not enqueued svc: socket %p no space, %d*2 > %ld, not enqueued svc: socket %p served by daemon %p <3>svc_sock_enqueue: server %p, rq_sock=%p! svc: socket %p put into queue svc: socket %p dequeued, inuse=%d svc: releasing dead socket <3>RPC request reserved %d but used %d svc: daemon %p woken up. svc: socket %p sendto([%p %Zu... ], %d, %d) = %d svc: socket %p recvfrom(%p, %Zu) = %d svc: socket %p(inet %p), count=%d, busy=%d svc: socket %p(inet %p), write_space busy=%d svc: recvfrom returned error %d svc: socket %p TCP (listen) state change %d svc: socket %p: no user data svc: socket %p TCP (connected) state change %d (svsk %p) svc: socket %p TCP data ready (svsk %p) svc: tcp_accept %p sock %p <4>%s: no more sockets! svc: tcp_accept %p allocated <4>%s: accept failed (err %d)! <4>%s: peername failed (err %d)! <4>%s: connect from unprivileged port: %u.%u.%u.%u:%d %s: connect from %u.%u.%u.%u:%04x svc: tcp_recv %p data %d conn %d close %d svc: short recvfrom while reading record length (%d of %ld) <5>RPC: bad TCP reclen 0x%08lx (non-terminal) svc: TCP record, %d bytes <5>RPC: bad TCP reclen 0x%08lx (large) svc: incomplete TCP record (%d of %d) svc: TCP complete record (%d bytes) RPC: TCP recvfrom got EAGAIN <5>%s: recvfrom returned errno %d <5>rpc-srv/tcp: %s: sent only %d bytes of %d - shutting down socket setting up TCP socket for listening setting up TCP socket for reading svc: server %p waiting for data (to = %ld) <3>svc_recv: service %p, socket not NULL! <3>svc_recv: service %p, wait queue active! svc: server %p, no data yet svc: server %p, socket %p, inuse=%d svc: got len=%d svc: socket %p dropped request <4>NULL socket pointer in %s:%d svcsock.csvc: svc_setup_socket %p <4>svsk->sk_sk == NULL after svc_prot_init! svc: svc_setup_socket created %p (inet %p) svc: svc_create_socket(%s, %d, %u.%u.%u.%u:%d) <4>svc: only UDP and TCP sockets supported svc: svc_create_socket error = %d svc: svc_delete_socket(%p) <5>svc: server socket destroy delayed svc: creating socket proto = %d svc: svc_authenticate (%d) svc: bad null cred svc: bad null verf unknownRPC: %4d rpc_getport(%s, %d, %d, %d) RPC: %4d pmap_getport_done(status %d, port %d) RPC: registering (%d, %d, %d, %d) with portmapper. localhostRPC: couldn't create pmap client <4>RPC: failed to contact portmap (errno %d). RPC: registration status %d/%d RPC: xdr_encode_mapping(%d, %d, %d, %d) pmap_getpmap_unsetpmap_setpmap_nullportmapunknown<7>RPC: Urk! Large shift of short iovec. unknownunknownnet %d %d %d %d rpc %d %d %d proc%d %d %drpc %d %d %d %d %d RPC: registering /proc/net/rpc/%s RPC: registering /proc/net/rpc net/rpcRPC: unregistering /proc/net/rpc unknown%dnlm_debugnfsd_debugnfs_debugrpc_debugsunrpcBUG: dst underflow %d: %p <3>vlan: failed to realloc headroom <3>vlan: failed to unshare skbuff <7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value token-ringipv4ethernet802core<3>nwfpe: bad structure size <3>nwfpe: bad register size nwfpe<4>NetWinder Floating Point Emulator V0.97 (extended precision) ?@@@@?@?@@@@?$@?@@@@@? A33UU UU "]6hE1+2F g - Z))Vy h4Lthi@i8iHi\i8i4Lj xj xjjjjddj8 98l=XlE 9=Xllll)$Q)l0123456789abcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ<4>improper call of vsnprintf! <5>This architecture does not implement dump_stack() request_dmafree_dmaenable_dmadisable_dmaset_dma_addrset_dma_countset_dma_modeset_dma_pageget_dma_residueset_dma_sgset_dma_speeddma_channel_activedma_spin_lockleds_eventkern_fp_enterfp_printkfp_send_sigkd_mksound__do_softirqdump_threaddump_fpu__udelay__ndelay__const_delay__ioremap__iounmapkernel_threadsystem_revsystem_serial_lowsystem_serial_high__bad_xchg__readwrite_bugenable_irqdisable_irqpm_idlepm_power_off__machine_arch_typecsum_partial_copy_nocheck__csum_ipv6_magic__raw_readsb__raw_readsw__raw_readsl__raw_writesb__raw_writesw__raw_writeslquicklistsstrcpystrncpystrcatstrncatstrcmpstrncmpstrchrstrlenstrnlenstrpbrkstrtokstrrchrstrstrmemsetmemcpymemmovememcmpmemscanmemchr__memzero__arch_copy_from_user__arch_copy_to_user__arch_clear_user__arch_strnlen_userpci_alloc_consistentconsistent_allocconsistent_freeconsistent_sync__get_user_1__get_user_2__get_user_4__get_user_8__put_user_1__put_user_2__put_user_4__put_user_8__ashldi3__ashrdi3__divsi3__lshrdi3__modsi3__muldi3__ucmpdi2__udivdi3__umoddi3__udivmoddi4__udivsi3__umodsi3abortdo_div64set_bittest_and_set_bitclear_bittest_and_clear_bitchange_bittest_and_change_bitfind_first_zero_bitfind_next_zero_bitelf_platformelf_hwcapsys_writesys_readsys_lseeksys_opensys_exitsys_wait4__down_failed__down_interruptible_failed__down_trylock_failed__up_wakeupget_wchan_memcpy_fromio_memcpy_toio_memset_iocpu_sa110_cache_clean_invalidate_allcpu_sa110_cache_clean_invalidate_rangecpu_sa110_flush_ram_pagecpu_sa110_dcache_clean_pagecpu_sa110_dcache_clean_entrycpu_sa110_dcache_clean_rangecpu_sa110_dcache_invalidate_rangecpu_sa110_icache_invalidate_rangecpu_sa110_icache_invalidate_pagecpu_sa110_tlb_invalidate_allcpu_sa110_tlb_invalidate_rangecpu_sa110_tlb_invalidate_pagecpu_sa110_set_pgdcpu_sa110_set_pmdcpu_sa110_set_ptemem_fclk_21285gpio_lockgpio_modify_opgpio_modify_iocpld_modifycopy_fs_structregister_exec_domainunregister_exec_domain__set_personalityabi_defhandler_coffabi_defhandler_elfabi_defhandler_lcall7abi_defhandler_libcsoabi_traceflgabi_fake_utsnameprintkacquire_console_semconsole_printconsole_unblankregister_consoleunregister_consoledequeue_signalflush_signalsforce_sigforce_sig_infokill_pgkill_pg_infokill_prockill_proc_infokill_slkill_sl_infonotify_parentrecalc_sigpendingsend_sigsend_sig_infoblock_all_signalsunblock_all_signalsnotifier_chain_registernotifier_chain_unregisternotifier_call_chainregister_reboot_notifierunregister_reboot_notifierin_group_pin_egroup_photplug_pathexec_usermodehelpercall_usermodehelperrequest_moduleschedule_taskflush_scheduled_tasksinter_module_registerinter_module_unregisterinter_module_getinter_module_get_requestinter_module_puttry_inc_mod_countdo_mmap_pgoffdo_munmapdo_brkdo_brk_lockedexit_mmexit_filesexit_fsexit_sighand_alloc_pages__alloc_pagesalloc_pages_node__get_free_pagesget_zeroed_page__free_pagesfree_pagesnum_physpageskmem_find_general_cachepkmem_cache_createkmem_cache_destroykmem_cache_shrinkkmem_cache_allockmem_cache_freekmem_cache_sizekmallockfreevfree__vmallocvmapvmalloc_to_pagevcallocmem_mapremap_page_rangemax_mapnrhigh_memoryvmtruncatefind_vmaget_unmapped_areainit_mmdef_blk_fopsupdate_atimeget_fs_typeget_superdrop_supergetnamenames_cachepfputfgetigrabiuniqueilookupiget4_lockedunlock_new_inodeiputinode_init_once__inode_init_onceforce_deletefollow_upfollow_downlookup_mntpath_initpath_walkpath_lookuppath_release__user_walklookup_one_lenlookup_hashsys_closedcache_lockd_alloc_rootd_deletedget_lockedd_validated_rehashd_invalidated_moved_instantiated_allocd_lookup__d_pathmark_buffer_dirtyset_buffer_async_ioend_buffer_io_async__mark_buffer_dirty__mark_inode_dirtyfd_installget_empty_filpinit_private_filefilp_openfilp_closeput_filpfiles_lockcheck_disk_change__invalidate_buffersinvalidate_bdevinvalidate_inodesinvalidate_deviceinvalidate_inode_pagestruncate_inode_pagesfsync_devfsync_dev_lockfsunlockfsfsync_no_superpermissionvfs_permissioninode_setattrinode_change_okwrite_inode_nownotify_changeset_blocksizesb_set_blocksizesb_min_blocksizegetblkcdgetcdputbdgetbdputbread__brelse__bforgetll_rw_blocksubmit_bhunlock_buffer__wait_on_buffer___wait_on_pagegeneric_direct_IOdiscard_bh_pageblock_write_full_pageblock_read_full_pageblock_prepare_writeblock_sync_pagegeneric_cont_expandcont_prepare_writegeneric_commit_writeblock_truncate_pagegeneric_block_bmapgeneric_file_readdo_generic_file_readdo_generic_file_writedo_generic_direct_readdo_generic_direct_writegeneric_file_writegeneric_file_mmapgeneric_ro_fopsgeneric_buffer_fdatasyncpage_hash_bitspage_hash_tablefile_lock_listlocks_init_locklocks_copy_lockposix_lock_fileposix_test_lockposix_block_lockposix_unblock_lockposix_locks_deadlocklocks_mandatory_areadputhave_submountsd_find_aliasd_prune_aliasesprune_dcacheshrink_dcache_sbshrink_dcache_parentfind_inode_numberis_subdirget_unused_fdput_unused_fdvfs_createvfs_mkdirvfs_mknodvfs_symlinkvfs_linkvfs_rmdirvfs_unlinkvfs_renamevfs_statfsgeneric_read_dirgeneric_file_llseekno_llseek__pollwaitpoll_freewaitROOT_DEV__find_get_page__find_lock_pagefind_trylock_pagefind_or_create_pagegrab_cache_page_nowaitread_cache_pageset_page_dirtymark_page_accessedvfs_readlinkvfs_follow_linkpage_readlinkpage_follow_linkpage_symlink_inode_operationsblock_symlinkvfs_readdir__get_leaselease_get_mtimelock_may_readlock_may_writedcache_dir_opendcache_dir_closedcache_dir_lseekdcache_dir_fsyncdcache_readdirdcache_dir_opsdefault_llseekdentry_openfilemap_nopagefilemap_syncfilemap_fdatawritefilemap_fdatasyncfilemap_fdatawaitlock_pageunlock_pagewakeup_page_waitersregister_chrdevunregister_chrdevregister_blkdevunregister_blkdevtty_register_drivertty_unregister_drivertty_std_termiosblksize_sizehardsect_sizeblk_sizeblk_devis_read_onlyset_device_robmapsync_devdevfs_register_partitionsblkdev_openblkdev_getblkdev_putioctl_by_bdevgrok_partitionsregister_disktq_diskinit_bufferrefile_buffermax_sectorsmax_readaheadtty_hanguptty_vhanguptty_wait_until_senttty_check_changetty_hung_up_ptty_flip_buffer_pushtty_get_baud_ratedo_SAKregister_filesystemunregister_filesystemkern_mount__mntputmay_umountregister_binfmtunregister_binfmtsearch_binary_handlerprepare_binprmcompute_credsremove_arg_zeroset_binfmtregister_sysctl_tableunregister_sysctl_tablesysctl_stringsysctl_intvecsysctl_jiffiesproc_dostringproc_dointvecproc_dointvec_jiffiesproc_dointvec_minmaxproc_doulongvec_ms_jiffies_minmaxproc_doulongvec_minmaxadd_timerdel_timerrequest_irqfree_irqirq_statadd_wait_queueadd_wait_queue_exclusiveremove_wait_queuewait_for_completioncompleteprobe_irq_onprobe_irq_offmod_timertq_timertq_immediatealloc_kiovecfree_kiovecexpand_kiobufmap_user_kiobufunmap_kiobuflock_kiovecunlock_kiovecbrw_kioveckiobuf_wait_for_iorequest_resourcerelease_resourceallocate_resourcecheck_resource__request_region__check_region__release_regionioport_resourceiomem_resourcecomplete_and_exit__wake_up__wake_up_syncwake_up_processsleep_onsleep_on_timeoutinterruptible_sleep_oninterruptible_sleep_on_timeoutscheduleschedule_timeoutyield__cond_reschedjiffiesxtimedo_gettimeofdaydo_settimeofdayloops_per_jiffykstatnr_runningpanicpanic_notifier_listpanic_timeout__out_of_line_bugsprintfsnprintfsscanfvsprintfvsnprintfvsscanfkdevnamebdevnamecdevnamesimple_strtolsimple_strtoulsimple_strtoullsystem_utsnameuts_semsys_call_tablemachine_restartmachine_haltmachine_power_off_ctypesecure_tcp_sequence_numberget_random_bytessecurebitscap_bsetreparent_to_initdaemonizecsum_partialseq_escapeseq_printfseq_openseq_releaseseq_readseq_lseeksingle_opensingle_releaseseq_release_privatesetup_arg_pagescopy_strings_kerneldo_execveflush_old_execkernel_readopen_execsi_meminfosys_tzfile_fsyncfsync_buffers_listclear_inode___strtokinit_special_inoderead_aheadget_hash_tablenew_inodeinsert_inode_hashremove_inode_hashbuffer_insert_listmake_bad_inodeis_bad_inodeeventbrw_page__inode_dir_notifyoverflowuidoverflowgidfs_overflowuidfs_overflowgidfasync_helperkill_fasyncdisk_nameget_write_accessstrnicmpstrspnstrseptasklet_hi_vectasklet_vecbh_task_vecinit_bhremove_bhtasklet_inittasklet_kill__run_task_queuedo_softirqraise_softirqcpu_raise_softirq__tasklet_schedule__tasklet_hi_scheduleinit_task_uniontasklist_lockpidhashunshare_filesdump_stack_endpm_registerpm_unregisterpm_unregister_allpm_sendpm_send_allpm_findpm_activeget_user_pagesvm_max_readaheadvm_min_readaheadfail_writepagezone_tableshmem_file_setupmempool_createmempool_resizemempool_destroymempool_allocmempool_freemempool_alloc_slabmempool_free_slabgeneric_file_openbalance_dirtyset_buffer_flushtimeget_buffer_flushtimeput_unused_buffer_headget_unused_buffer_headset_bh_pagecreate_empty_bufferswriteout_one_pagewaitfor_one_pagetry_to_free_buffersbh_cachepnfsd_linkageregister_quota_formatunregister_quota_formatdqstatsinit_dquot_operationsmb_cache_createmb_cache_shrinkmb_cache_destroymb_cache_entry_allocmb_cache_entry_insertmb_cache_entry_releasemb_cache_entry_takeoutmb_cache_entry_freemb_cache_entry_dupmb_cache_entry_getmb_cache_entry_find_firstmb_cache_entry_find_nextproc_sys_rootproc_symlinkproc_mknodproc_mkdircreate_proc_entryremove_proc_entryproc_rootproc_root_fsproc_netproc_busproc_root_driverproc_get_inodejournal_startjournal_try_startjournal_restartjournal_extendjournal_stopjournal_lock_updatesjournal_unlock_updatesjournal_get_write_accessjournal_get_create_accessjournal_get_undo_accessjournal_dirty_datajournal_dirty_metadatajournal_release_bufferjournal_forgetjournal_flushjournal_revokejournal_callback_setjournal_init_devjournal_init_inodejournal_update_formatjournal_check_used_featuresjournal_check_available_featuresjournal_set_featuresjournal_createjournal_loadjournal_destroyjournal_recoverjournal_update_superblockjournal_abortjournal_errnojournal_ack_errjournal_clear_errlog_wait_commitlog_start_commitjournal_wipejournal_blocks_per_pagejournal_flushpagejournal_try_to_free_buffersjournal_bmapjournal_force_commitdevfs_putdevfs_registerdevfs_unregisterdevfs_mk_symlinkdevfs_mk_dirdevfs_get_handledevfs_find_handledevfs_get_flagsdevfs_set_flagsdevfs_get_maj_mindevfs_get_handle_from_inodedevfs_generate_pathdevfs_get_opsdevfs_set_file_sizedevfs_get_infodevfs_set_infodevfs_get_parentdevfs_get_first_childdevfs_get_next_siblingdevfs_auto_unregisterdevfs_get_unregister_slavedevfs_get_namedevfs_register_chrdevdevfs_register_blkdevdevfs_unregister_chrdevdevfs_unregister_blkdevdevfs_register_tapedevfs_register_seriesdevfs_alloc_majordevfs_dealloc_majordevfs_alloc_devnumdevfs_dealloc_devnumdevfs_alloc_unique_numberdevfs_dealloc_unique_numberlockd_uplockd_downnlmclnt_procnlmsvc_invalidate_clientnlmsvc_opsregister_nlsunregister_nlsunload_nlsload_nlsload_nls_defaultutf8_mbtowcutf8_mbstowcsutf8_wctombutf8_wcstombsuart_update_timeoutuart_write_wakeupuart_register_driveruart_unregister_driveruart_register_portuart_unregister_portuart_add_one_portuart_remove_one_portregister_serialunregister_serialserial8250_get_irq_maptty_register_ldiscGPLONLY_tty_ldisc_getGPLONLY_tty_ldisc_putGPLONLY_tty_ldisc_ref_waitGPLONLY_tty_ldisc_refGPLONLY_tty_ldisc_derefGPLONLY_tty_wakeupGPLONLY_tty_ldisc_flushtty_register_devfstty_unregister_devfsn_tty_ioctlmisc_registermisc_deregisteradd_keyboard_randomnessadd_mouse_randomnessadd_interrupt_randomnessadd_blkdev_randomnessbatch_entropy_storegenerate_random_uuidcolor_tabledefault_reddefault_grndefault_bluvideo_font_heightvideo_scan_linesvc_resizefg_consoleconsole_blank_hookvt_constake_over_consolegive_up_consoleset_selectionpaste_selectionhandle_scancodekbd_ledfunckbd_refresh_ledskeyboard_taskletreq_finished_ioio_request_lockend_that_request_firstend_that_request_lastblk_grow_request_listblk_init_queueblk_get_queueblk_cleanup_queueblk_queue_headactiveblk_queue_throttle_sectorsblk_queue_make_requestgeneric_make_requestblkdev_release_requestgeneric_unplug_deviceblk_queue_bounce_limitblk_max_low_pfnblk_max_pfnblk_seg_merge_okblk_nohighioblk_ioctlgendisk_headadd_gendiskdel_gendiskget_gendiskalloc_netdevinit_etherdevalloc_etherdevinit_fddidevalloc_fddidevinit_hippi_devalloc_hippi_devregister_hipdevunregister_hipdevether_setupfddi_setuphippi_setupltalk_setupregister_netdevunregister_netdevtr_setupinit_trdevalloc_trdevregister_trdevunregister_trdevfc_setupinit_fcdevalloc_fcdevregister_fcdevunregister_fcdevautoirq_setupautoirq_reportcomx_register_hardwarecomx_unregister_hardwarecomx_register_protocolcomx_unregister_protocolcomx_debug_skbcomx_debug_bytescomx_debugcomx_lineup_funccomx_statuscomx_rxcomx_strcasecmpcomx_root_dirunplugged_hwif_iopsdefault_hwif_iopsdefault_hwif_mmiopsdefault_hwif_transportread_24SELECT_DRIVESELECT_INTERRUPTSELECT_MASKQUIRK_LISTata_vlb_syncata_input_dataata_output_dataatapi_input_bytesatapi_output_byteside_fix_driveidide_fixstringdrive_is_readywait_for_readyide_wait_stateighty_ninty_threeide_ata66_checkset_transferide_auto_reduce_xferide_driveid_updateide_config_drive_speed__ide_set_handleride_set_handleride_execute_commandide_do_resettask_read_24taskfile_input_datataskfile_output_datataskfile_lib_get_identifydo_rw_taskfiletaskfile_dump_statuside_end_taskfiletask_try_to_flush_leftover_datataskfile_errorset_multmode_intrset_geometry_intrrecal_intrtask_no_data_intrtask_in_intrtask_mulin_intrpre_task_out_intrtask_out_intrpre_task_mulout_intrtask_mulout_intride_pre_handler_parseride_handler_parseride_post_handler_parseride_cmd_type_parseride_init_drive_taskfileide_diag_taskfileide_raw_taskfileide_taskfile_ioctlide_wait_cmdide_cmd_ioctlide_wait_cmd_taskide_task_ioctlflagged_taskfilenoautodmaide_hwifsidediskidecdidefloppyidetapeidescsicurrent_capacityide_dump_statuside_revalidate_diskide_probe_moduleide_driver_modulehwif_unregisteride_unregisteride_setup_portside_register_hwide_registeride_setting_semide_add_settingide_remove_settingide_spin_wait_hwgroupide_write_settingGPLONLY_ide_add_generic_settingside_delay_50mssystem_bus_clockide_replace_subdriveride_attach_driveide_register_driveride_scan_deviceside_register_subdriveride_unregister_subdriveride_register_moduleide_unregister_moduleide_fopside_geninitide_probeide_devfs_handleide_xfer_verboseide_dma_speedide_rate_filteride_dma_enableGPLONLY_ide_pio_timingsGPLONLY_ide_get_best_pio_modeide_toggle_bounceGPLONLY_ide_set_xfer_rateide_end_requestide_end_drive_cmdtry_to_flush_leftover_dataide_erroride_abortide_cmddrive_cmd_intrdo_specialexecute_drive_cmdide_stall_queueide_do_requestide_get_queuedo_ide_requestide_timer_expiryide_intride_info_ptride_init_drive_cmdide_do_drive_cmdprobe_hwifsave_matchinit_irqinit_gendiskhwif_initexport_ide_init_queueproc_ide_read_configproc_ide_read_driversproc_ide_read_imodelproc_ide_read_mateproc_ide_read_channelproc_ide_read_identifyproc_ide_read_settingsproc_ide_write_settingsproc_ide_read_capacityproc_ide_read_geometryproc_ide_read_dmodelproc_ide_read_driverproc_ide_write_driverproc_ide_read_mediaide_add_proc_entrieside_remove_proc_entriescreate_proc_ide_drivesdestroy_proc_ide_devicedestroy_proc_ide_drivescreate_proc_ide_interfacesdestroy_proc_ide_interfaceside_pci_register_host_procproc_ide_createproc_ide_destroyGPLONLY_ide_setup_pci_deviceGPLONLY_ide_setup_pci_devicesGPLONLY_ide_pci_register_driverGPLONLY_ide_pci_unregister_driverGPLONLY_ide_scan_pcibusGPLONLY_ide_dma_intrGPLONLY_ide_build_dmatableGPLONLY_ide_destroy_dmatable__ide_dma_host_off__ide_dma_off_quietly__ide_dma_off__ide_dma_host_on__ide_dma_on__ide_dma_check__ide_dma_read__ide_dma_write__ide_dma_begin__ide_dma_end__ide_dma_test_irq__ide_dma_bad_drive__ide_dma_good_drive__ide_dma_count__ide_dma_verbose__ide_dma_retune__ide_dma_lostirq__ide_dma_timeoutGPLONLY_ide_setup_dmaGPLONLY___ide_do_rw_diskpci_generic_suspend_savepci_generic_resume_restorepci_generic_resume_comparepci_read_config_bytepci_read_config_wordpci_read_config_dwordpci_write_config_bytepci_write_config_wordpci_write_config_dwordpci_devicespci_root_busespci_enable_device_barspci_enable_devicepci_disable_devicepci_find_capabilitypci_release_regionspci_request_regionspci_release_regionpci_request_regionpci_find_classpci_find_devicepci_find_slotpci_find_subsyspci_set_masterpci_set_mwipci_clear_mwipci_set_dma_maskpci_dac_set_dma_maskpci_assign_resourcepci_register_driverpci_unregister_driverpci_dev_driverpci_match_devicepci_find_parent_resourcepci_setup_devicepci_insert_devicepci_remove_devicepci_announce_device_to_driverspci_add_new_buspci_do_scan_buspci_scan_slotpci_scan_buspci_scan_devicepci_read_bridge_basespci_proc_attach_devicepci_proc_detach_devicepci_proc_attach_buspci_proc_detach_busproc_bus_pci_dirpci_set_power_statepci_save_statepci_restore_statepci_enable_wakepcibios_presentpcibios_read_config_bytepcibios_read_config_wordpcibios_read_config_dwordpcibios_write_config_bytepcibios_write_config_wordpcibios_write_config_dwordpcibios_find_classpcibios_find_deviceisa_dma_bridge_buggypci_pci_problemspciehp_msi_quirkpci_pool_createpci_pool_destroypci_pool_allocpci_pool_freeregister_mtd_chip_driverunregister_mtd_chip_driverdo_map_probemtd_do_chip_probeadd_mtd_devicedel_mtd_device__get_mtd_deviceregister_mtd_userunregister_mtd_userdefault_mtd_writevdefault_mtd_readvregister_framebufferunregister_framebufferregistered_fbnum_registered_fbGET_FB_IDXfb_alloc_cmapfb_copy_cmapfb_get_cmapfb_set_cmapfb_default_cmapfb_invert_cmaps__fb_try_modefb_displayfbcon_redraw_bmovefbcon_redraw_clearfbcon_dummyfb_concyber2000fb_attachcyber2000fb_detachcyber2000fb_enable_extregscyber2000fb_disable_extregscyber2000fb_get_fb_varfbgen_get_varfbgen_get_cmapfbgen_get_fixfbgen_set_varfbgen_set_cmapfbgen_set_dispfbgen_install_cmapfbgen_pan_displayfbgen_update_varfbgen_do_set_varfbgen_switchfbgen_blankfbcon_vga_planesfbcon_vga_planes_setupfbcon_vga_planes_bmovefbcon_vga_planes_clearfbcon_vga_planes_putcfbcon_vga_planes_putcsfbcon_vga_planes_revcfbcon_ega_planesfbcon_ega_planes_putcfbcon_ega_planes_putcsfbcon_cfb2fbcon_cfb2_setupfbcon_cfb2_bmovefbcon_cfb2_clearfbcon_cfb2_putcfbcon_cfb2_putcsfbcon_cfb2_revcfbcon_cfb4fbcon_cfb4_setupfbcon_cfb4_bmovefbcon_cfb4_clearfbcon_cfb4_putcfbcon_cfb4_putcsfbcon_cfb4_revcfbcon_cfb8fbcon_cfb8_setupfbcon_cfb8_bmovefbcon_cfb8_clearfbcon_cfb8_putcfbcon_cfb8_putcsfbcon_cfb8_revcfbcon_cfb8_clear_marginsfbcon_cfb16fbcon_cfb16_setupfbcon_cfb16_bmovefbcon_cfb16_clearfbcon_cfb16_putcfbcon_cfb16_putcsfbcon_cfb16_revcfbcon_cfb16_clear_marginsfbcon_cfb24fbcon_cfb24_setupfbcon_cfb24_bmovefbcon_cfb24_clearfbcon_cfb24_putcfbcon_cfb24_putcsfbcon_cfb24_revcfbcon_cfb24_clear_marginsfbcon_cfb32fbcon_cfb32_setupfbcon_cfb32_bmovefbcon_cfb32_clearfbcon_cfb32_putcfbcon_cfb32_putcsfbcon_cfb32_revcfbcon_cfb32_clear_marginsfbcon_mfbfbcon_mfb_setupfbcon_mfb_bmovefbcon_mfb_clearfbcon_mfb_putcfbcon_mfb_putcsfbcon_mfb_revcfbcon_mfb_clear_marginsfbcon_vgafbcon_vga_setupfbcon_vga_bmovefbcon_vga_clearfbcon_vga_putcfbcon_vga_putcsfbcon_vga_revcdev_ethtoolethtool_op_get_linkethtool_op_get_sgethtool_op_get_tx_csumethtool_op_set_sgethtool_op_set_tx_csumregister_8022_clientunregister_8022_clientregister_snap_clientunregister_snap_clientfc_type_transxfrm_user_policykm_waitqkm_new_mappingxfrm_cfg_semxfrm_policy_alloc__xfrm_policy_destroyxfrm_lookup__xfrm_policy_check__xfrm_route_forwardxfrm_state_alloc__xfrm_state_destroyxfrm_state_findxfrm_state_insertxfrm_state_addxfrm_state_updatexfrm_state_check_expirexfrm_state_check_spacexfrm_state_lookupxfrm_state_register_afinfoxfrm_state_unregister_afinfoxfrm_state_get_afinfoxfrm_state_put_afinfoxfrm_state_delete_tunnelxfrm_replay_checkxfrm_replay_advancexfrm_check_selectorsxfrm_check_output__secpath_destroysecpath_dupxfrm_get_acqseqxfrm_parse_spixfrm4_rcvxfrm4_tunnel_registerxfrm4_tunnel_deregisterxfrm4_tunnel_check_sizexfrm_register_typexfrm_unregister_typexfrm_get_typexfrm_register_kmxfrm_unregister_kmxfrm_state_deletexfrm_state_walkxfrm_find_acq_byseqxfrm_find_acqxfrm_alloc_spixfrm_state_flushxfrm_policy_killxfrm_policy_byselxfrm_policy_insertxfrm_policy_walkxfrm_policy_flushxfrm_policy_byidxfrm_policy_listxfrm_dst_lookupxfrm_policy_register_afinfoxfrm_policy_unregister_afinfoxfrm_policy_get_afinfoxfrm_policy_put_afinfoGPLONLY_xfrm_probe_algsGPLONLY_xfrm_count_auth_supportedGPLONLY_xfrm_count_enc_supportedGPLONLY_xfrm_aalg_get_byidxGPLONLY_xfrm_ealg_get_byidxGPLONLY_xfrm_calg_get_byidxGPLONLY_xfrm_aalg_get_byidGPLONLY_xfrm_ealg_get_byidGPLONLY_xfrm_calg_get_byidGPLONLY_xfrm_aalg_get_bynameGPLONLY_xfrm_ealg_get_bynameGPLONLY_xfrm_calg_get_bynameGPLONLY_skb_icv_walkaarp_send_ddpatrtr_get_devatalk_find_dev_addrrpc_allocaterpc_freerpc_executerpc_init_taskrpc_sleep_onrpc_wake_up_nextrpc_wake_up_taskrpc_new_childrpc_run_childrpciod_downrpciod_uprpc_new_taskrpc_wake_up_statusrpc_release_taskrpc_create_clientrpc_destroy_clientrpc_shutdown_clientrpc_killall_tasksrpc_call_syncrpc_call_asyncrpc_call_setuprpc_clnt_sigmaskrpc_clnt_sigunmaskrpc_delayrpc_restart_callrpc_setbufsizexprt_create_protoxprt_destroyxprt_set_timeoutrpcauth_registerrpcauth_unregisterrpcauth_init_credcacherpcauth_free_credcacherpcauth_insert_credcacherpcauth_lookupcredrpcauth_bindcredrpcauth_matchcredput_rpccredsvc_createsvc_create_threadsvc_exit_threadsvc_destroysvc_dropsvc_processsvc_recvsvc_wake_upsvc_makesocksvc_reserverpc_proc_registerrpc_proc_unregisterrpc_proc_readsvc_proc_registersvc_proc_unregistersvc_proc_readxdr_encode_arrayxdr_encode_stringxdr_decode_stringxdr_decode_string_inplacexdr_decode_netobjxdr_encode_netobjxdr_encode_pagesxdr_inline_pagesxdr_shift_bufrpc_debugnfs_debugnfsd_debugnlm_debugskb_over_panicskb_under_panicskb_padsock_registersock_unregister__lock_sock__release_sockmemcpy_fromiovecmemcpy_tokerneliovecsock_createsock_allocsock_releasesock_setsockoptsock_getsockoptsock_sendmsgsock_recvmsgsk_allocsk_freesock_wake_asyncsock_alloc_send_skbsock_alloc_send_pskbsock_init_datasock_no_releasesock_no_bindsock_no_connectsock_no_socketpairsock_no_acceptsock_no_getnamesock_no_pollsock_no_ioctlsock_no_listensock_no_shutdownsock_no_getsockoptsock_no_setsockoptsock_no_sendmsgsock_no_recvmsgsock_no_mmapsock_no_sendpagesock_rfreesock_wfreesock_wmallocsock_rmallocskb_linearizeskb_checksumskb_checksum_helpskb_recv_datagramskb_free_datagramskb_copy_datagramskb_copy_datagram_iovecskb_copy_and_csum_datagram_iovecskb_copy_bitsskb_copy_and_csum_bitsskb_copy_and_csum_devskb_copy_expand___pskb_trim__pskb_pull_tailpskb_expand_headpskb_copyskb_realloc_headroomdatagram_pollput_cmsgsock_kmallocsock_kfree_ssock_map_fdsockfd_lookupsk_run_filtersk_chk_filterneigh_table_initneigh_table_clearneigh_resolve_outputneigh_connected_outputneigh_updateneigh_createneigh_lookup__neigh_event_sendneigh_event_nsneigh_ifdownneigh_sysctl_registerneigh_sysctl_unregisterpneigh_lookuppneigh_enqueueneigh_destroyneigh_parms_allocneigh_parms_releaseneigh_rand_reach_timeneigh_compat_outputneigh_changeaddrdst_alloc__dst_freedst_destroynet_ratelimitnet_randomnet_srandom__scm_destroy__scm_sendscm_fp_dupfiles_statmemcpy_toiovecmake_8023_clientdestroy_8023_clientmake_EII_clientdestroy_EII_clientdev_change_flagsvlan_ioctl_hooksklist_destroy_socketsklist_insert_socketscm_detach_fdsbr_handle_frame_hookbr_ioctl_hookinetdev_lockinet_add_protocolinet_del_protocolinet_register_protoswinet_unregister_protoswip_route_output_keyip_route_inputicmp_sendicmp_statisticsicmp_err_convertip_options_compileip_options_undoarp_createarp_xmitarp_sendarp_broken_ops__ip_select_identip_send_checkip_fragmentinet_family_opsin_atonip_mc_inc_groupip_mc_dec_groupip_mc_join_groupip_finish_outputinet_stream_opsinet_dgram_opsip_cmsg_recvinet_addr_typeinet_select_addrip_dev_findinetdev_by_indexin_dev_finish_destroyip_defragipfrag_flushinet_peer_idlockip_rt_ioctldevinet_ioctlregister_inetaddr_notifierunregister_inetaddr_notifierip_statisticsdlci_ioctl_hookflow_cache_lookupflow_cache_genidinet_releaseinet_stream_connectinet_dgram_connectinet_acceptinet_listeninet_shutdowninet_setsockoptinet_getsockoptinet_sendmsginet_recvmsginet_sock_destructinet_sock_releasetcp_hashinfotcp_listen_wlockudp_hashudp_hash_locktcp_destroy_sockip_queue_xmitmemcpy_fromiovecendcsum_partial_copy_fromiovecendtcp_v4_lookup_listenerudp_ioctludp_connectudp_disconnectudp_sendmsgtcp_closetcp_disconnecttcp_accepttcp_write_wakeuptcp_write_spacetcp_polltcp_ioctltcp_shutdowntcp_setsockopttcp_getsockopttcp_recvmsgtcp_send_synacktcp_check_reqtcp_child_processtcp_parse_optionstcp_rcv_establishedtcp_init_xmit_timerstcp_clear_xmit_timerstcp_statisticstcp_rcv_state_processtcp_timewait_state_processtcp_timewait_cacheptcp_timewait_killtcp_sendmsgtcp_v4_rebuild_headertcp_v4_send_checktcp_v4_conn_requesttcp_create_openreq_childtcp_bucket_create__tcp_put_porttcp_put_porttcp_inherit_porttcp_v4_syn_recv_socktcp_v4_do_rcvtcp_v4_connecttcp_unhashudp_prottcp_prottcp_openreq_cachepipv4_specifictcp_simple_retransmittcp_transmit_skbtcp_connecttcp_make_synacktcp_tw_descheduletcp_delete_keepalive_timertcp_reset_keepalive_timersysctl_local_port_rangetcp_port_roverudp_port_rovertcp_sync_mssnet_statistics__tcp_mem_reclaimtcp_sockets_allocatedsysctl_tcp_reorderingsysctl_tcp_rmemsysctl_tcp_wmemsysctl_tcp_ecntcp_cwnd_application_limitedtcp_sendpagesysctl_tcp_low_latencytcp_write_xmittcp_v4_remember_stampsysctl_tcp_tw_recyclesysctl_max_syn_backlogsecure_tcpv6_sequence_numbersecure_ipv6_idip_generic_getfragtcp_read_socknetlink_set_errnetlink_broadcastnetlink_unicastnetlink_kernel_createnetlink_dump_startnetlink_acknetlink_set_nonrootnetlink_register_notifiernetlink_unregister_notifiernetlink_attachnetlink_detachnetlink_postrtattr_parsertnetlink_links__rta_fillrtnetlink_dump_ifinfortnetlink_put_metricsrtnlneigh_deleteneigh_addneigh_dump_infodev_set_allmultidev_set_promiscuitysklist_remove_socketrtnl_semrtnl_lockrtnl_unlockmove_addr_to_kernelmove_addr_to_useripv4_configdev_openxrlim_allowip_rcvarp_rcvarp_tblarp_findtr_type_transregister_netdevice_notifierunregister_netdevice_notifierloopback_devregister_netdeviceunregister_netdevicesynchronize_netnetdev_state_changedev_new_indexdev_get_by_flags__dev_get_by_flagsdev_get_by_index__dev_get_by_indexdev_get_by_name__dev_get_by_namenetdev_finish_unregisternetdev_set_mastereth_type_transfddi_type_transalloc_skb__kfree_skbskb_cloneskb_copynetif_rxnetif_receive_skbdev_add_packdev_remove_packdev_getdev_allocdev_alloc_name__netdev_watchdog_updev_loaddev_ioctldev_queue_xmitdev_basedev_base_lockdev_closedev_mc_adddev_mc_deletedev_mc_upload__kill_fasyncif_port_texthippi_type_transsysctl_wmem_maxsysctl_rmem_maxsysctl_optmem_maxsysctl_ip_default_ttlqdisc_destroyqdisc_resetqdisc_restartqdisc_create_dfltnoop_qdiscqdisc_tree_lockpsched_time_basepsched_time_markpfifo_qdisc_opsbfifo_qdisc_opsregister_qdiscunregister_qdiscqdisc_get_rtabqdisc_put_rtabqdisc_copy_statsqdisc_new_estimatorqdisc_kill_estimatorregister_tcf_proto_opsunregister_tcf_proto_opsnf_register_hooknf_unregister_hooknf_register_sockoptnf_unregister_sockoptnf_reinjectnf_register_queue_handlernf_unregister_queue_handlernf_hook_slownf_hooksnf_setsockoptnf_getsockoptip_ct_attachip_route_me_harderregister_gifconfsoftnet_datawireless_send_eventiw_handler_set_spyiw_handler_get_spyiw_handler_set_thrspyiw_handler_get_thrspywireless_spy_updatememparseget_optionget_optionsrb_insert_colorrb_eraseinit_rwsem__down_read__down_write__up_read__up_writey`yhypyxz(z :#:#:#:x :@ :Ȏ ;ĕ ; (;(#8; D;X; l;D|; ;4 ;\ ; ; ; ; < <@ << T<, l< <T <-#<-#< <H<H <#=L== (=4=D=8T=d=t=====X===H==<>`>(>4>@>(P><d>p>|>>>x>>;><><?4=?( 4? D?X?(&d?\$x?%?:?d#?T]?_?`?a?a@w@w@ x,@4x8@(bD@pbT@cd@ct@ d@`d@pd@8e@e@4f@g@gAhAh Ai8A`kLADpdApxApAlwAAxAxA`yAyB|B,B؁@BH`B<pBBxBȅBhBBHBB`BC,(C@CTClCCCC̜C@CCCDD,D#8D $DD $LD $TD $`D $hDܲpD DD\DDDDD4EE< EH0ED@ETExlEEEEEE[EFF@4FHPFdF`|FF#F $FhFFF FFG80GDG`GpGtGGGlGGGtGDGxHH H0HDHPH`HtHHH\HH!H#H|,H .H.I@0(I0JH?K,MKDM8KxMXKMxK`]KNKRK@TKULVL8V4LlVDLVXLVhL WxLXLYLTYLYL(ZLtZLZLZMh\M\0M\DMXbXM,jpMXM|MM8MhMN(N,@N|XNpNx|N̛NNNxNN0NOO0O@OPOX`OħpǪO(OxOOOPOȢOP0PX,PHP\PPpPdPtP@PDPĶPdPP Q$QL`D``Ct`B`D$`8`?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~i  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~~ 0 notS H H 0 H @}  x rrK%  `  ""sstts/FB%d $ 8@@( D) (  h ! ) * - - 0 6 3 4 p5 @6 ttyS6 8 T"\"" "("@s%@'@(@%P'P6@7@8@x@y@@@@7PxPyPPy`ypy7878y7878yyyyU@V@@@VPVWVWVVWXYVWVWXYVWe@f@ePfPfffghfgh,t8ttttH< H< H<  H<  >  D> ]xP? = = = = = = = @@@   ^q^r^t^r^t^xvwP4S P1P!PPAPMPMjj!\ \ \P \` !  @'''(((0)1)2)4)5)6)P*Q*R* + + + + + +@ +A +B +0 ,1 ,2 ,` ,a ,b ,P -Q -R -.0/" hq #    `$]&zH %@z@ A L `K B HC C K `K LD E L K 8K PH dH `K $G G K 8K xH dH J 8K xH $K M  XT] _ r z m q r XTXW xW W W q 2Kn,X` %K @B`%&-g5 =TH | H | ԓ L p ܽ 88 f31g4he4gL3@4' TT`` 8 < | 8 < Lp#\ <$(w$wt#x# w|###$ $  @@      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*!!!!/%123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $% $%% %%<%%%$%4%,%%d"e"`":&;&e&f&c&`&" %%%B&@&j&k&<&%%!< %!!!!!"!%% !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~# #%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%")"a"e"d" #!#H""" %  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~:&;&e&f&%c&`&" %%%B&@&j&k&<&%%%%!< %!!!!!"!%% !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJK*!LMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~#+! #%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%&!")"a"e"d" #!#H""" %`Ht   UUUUUUUUUUUUܙܙtty`u x X '#4 ܣ P D  8\  ؠ <  h  $ D D O`'^~",Tl 1234567890-= qwertyuiop[]asdfghjkl;'`\zxcvbnm,./      <   !@#$%^&*()_+ QWERTYUIOP{}ASDFGHJKL:"~|ZXCVBNM<>?     >     @${[]}\qwrtyuiop~sghjklzxvnm    |                   1234567890-= qwertyuiop[] asdfghjkl;'`\zxcvbnm,./      <                     [[A[[B[[C[[D[[E[17~[18~[19~[20~[21~[23~[24~[25~[26~[28~[29~[31~[32~[33~[34~[1~[2~[3~[4~[5~[6~$$).38=CIOU[agmsy`A`a'A'a^A^a~A~a"A"aOAoa0A0aAAaaAEae,C,c`E`e'E'e^E^e"E"e`I`i'I'i^I^i"I"i-D-d~N~n`O`o'O'o^O^o~O~o"O"o/O/o`U`u'U'u^U^u"U"u'Y'yTHthss"yszijD|}~z{YxZ[\]^_|y`abcdqrstuefghi|jvklmno}~p $  X  2LL@lX`(whmhlmXT  0  hp84$ |ܱ<<8 H A   $ eth%d=eth%d=eth%dX=eth%d=eth%d=eth%dx=eth%dع=eth%d8=tr%dtr%dtr%dXtr%dtr%dtr%dxtr%dtr%d8fddi7t>fddi6t>fddi5Xt>fddi4t>fddi3t>fddi2xt>fddi1t>fddi08t>fc1fc0loX?95X8;|t d@\PH)R@DE tdTD4$)RtHKQQWW@SUWWTVXXXNxON@@|Z ЈPPp[CGB 0PPp[eexPPp[`pPPp[`jhPPp[`:g\PPp[3PPPp[aHPPp[EX<PPp[y0PPp[y$PPp[yPPp[ B 0ee``j`:g3aEXy y y [xV4 $6HH  "BDEF|pdXL@4(p\H4,$ t\D,P\ 0$# $8 9 \1 $d9$8X2X4< $04 |,\', $@0$.ddt%p%\%p%H%p%<%p%'p%'p%'p%'p%'p%'''t'`'p%T'p%H'p%<'p%0'p%('p%'p%'p%&p%&p%&p%&p%&p%&p%x&p%d&p%P&p%8&p%,&p%&p%%p%%p%'p%%p%%p%%p%%p%t/$̃h/$P7X/D/\00 ($D p`r$spwy8 IOBus Bridge Hot Swap9036PCI <-> IOBus BridgePCI <-> IOBus Bridge90609060SD9060ES9080Madge NetworksSmart 16/4 PCI RingnodeSmart 16/4 PCI Ringnode Mk2Smart 16/4 PCI Ringnode Mk3Smart 16/4 PCI Ringnode Mk116/4 Cardbus AdapterPresto PCI AdapterSmart 100/16/4 PCI-HS RingnodeSmart 100/16/4 PCI Ringnode16/4 CardBus Adapter Mk2RapidFire 3140V2 16/4 TR AdapterCollage 25/155 ATM Client AdapterCollage 155 ATM Server Adapter3Com Corporation3c985 1000BaseSX (SX/TX)3C910-A01MINI PCI type 3B Data Fax ModemMini PCI 56k WinmodemGigabit Ethernet Adapter3c339 TokenLink Velocity3c359 TokenLink Velocity XL3c450 Cyclone/unknown3c555 Laptop Hurricane3c575 [Megahertz] 10/100 LAN CardBus3c575 [Megahertz] 10/100 LAN CardBus3CCFE575CT Cyclone CardBus3c590 10BaseT [Vortex]3c592 EISA 10mbps Demon/Vortex3c595 100BaseTX [Vortex]3c595 100BaseT4 [Vortex]3c595 100Base-MII [Vortex]3c597 EISA Fast Demon/Vortex3c595 [Megahertz] 10/100 LAN CardBus3c556 Hurricane CardBus3c556B Hurricane CardBus3CCFE656 Cyclone CardBus3CCFEM656 10/100 LAN+56K Modem CardBus3CCFEM656 [id 6562] Cyclone CardBus3CCFEM656B 10/100 LAN+56K Modem CardBus3CCFEM656 [id 6564] Cyclone CardBus3cSOHO100-TX Hurricane3c803 FDDILink UTP Controller3c804 FDDILink SAS Controller3c805 FDDILink DAS ControllerToken ring3c900 10BaseT [Boomerang]3c900 Combo [Boomerang]3c900B-TPO [Etherlink XL TPO]3c900B-Combo [Etherlink XL Combo]3c900B-TPC [Etherlink XL TPC]3c900B-FL [Etherlink XL FL]3c905 100BaseTX [Boomerang]3c905 100BaseT4 [Boomerang]3c905B 100BaseTX [Cyclone]3c905B-T4 [Fast EtherLink XL 10/100]3c905B-Combo [Deluxe Etherlink XL 10/100]3c905B-FX [Fast Etherlink XL FX 10/100]3c905C-TX/TX-M [Tornado]3C920B-EMB Integrated Fast Ethernet Controller3CSOHO100B-TX [910-A01]3c980-TX [Fast Etherlink XL Server Adapter]3c980-TX 10/100baseTX NIC [Python-T]3C990-TX [Typhoon]3CR990-TX-95 [Typhoon 56-bit]3CR990-TX-97 [Typhoon 168-bit]3C990B-TX-M/3C990BSVR [Typhoon2]3CR990-FX-95/97/95 [Typhon Fiber]3CR990SVR95 [Typhoon Server 56-bit]3CR990SVR97 [Typhoon Server 168-bit]3C990SVR [Typhoon Server]Standard Microsystems Corp [SMC]83C170QFLANEPICFDC 37c665FDC 37C92283C170QFSMC34C90ALi CorporationC-Media CMI8738/C3DX Audio Device (OEM)M1435M1445M1449M1451M1461M1489M1511 [Aladdin]M1512 [Aladdin]M1513 [Aladdin]M1521 [Aladdin III]M1523M1531 [Aladdin IV]M1533 PCI to ISA Bridge [Aladdin IV]M1541M1543M1563 HyperTransport South BridgeM1621ALI M1631 PCI North Bridge Aladdin Pro IIIM1632M Northbridge+TridentALI M1641 PCI North Bridge Aladdin Pro IVM1644/M1644T Northbridge+TridentM1646 Northbridge+TridentM1647 Northbridge [MAGiK 1 / MobileMAGiK 1]M1651/M1651T Northbridge [Aladdin-Pro 5/5M,Aladdin-Pro 5T/5TM]M1671 Super P4 Northbridge [AGP4X,PCI and SDR/DDR]M1681 P4 Northbridge [AGP8X,HyperTransport and SDR/DDR]M1687 K8 Northbridge [AGP8X and HyperTransport]M3141M3143M3145M3147M3149M3151M3307M3309M4803MS4803M5217HM5219M5225M5229 IDEM5225USB 1.1 ControllerUSB 2.0 ControllerM1541 PCI to AGP ControllerPCI to AGP ControllerM5249 HTT to PCI BridgeM5251 P1394 OHCI 1.0 ControllerM5253 P1394 OHCI 1.1 ControllerM5261 Ethernet ControllerLucent Technologies Soft Modem AMRM5451 PCI AC-Link Controller Audio DeviceM5453 PCI AC-Link Controller Modem DeviceM5455 PCI AC-Link Controller Audio DeviceIntel 537 [M5457 AC-Link Modem]SmartLink SmartPCI561 56K ModemSmartLink SmartPCI563 56K ModemM5471 Memory Stick ControllerM5473 SD-MMC ControllerM7101 PMUMitsubishi Electric Corp.AccelGraphics AccelECLIPSEDapha Electronics CorporationAdvanced Logic ResearchSurecom TechnologyNE-34Tseng Labs International Co.Most IncBoca Research Inc.ICM Co., Ltd.Auspex Systems Inc.Samsung Semiconductors, Inc.Smartether100 SC1100 LAN Adapter (i82557B)Award Software International Inc.Xerox CorporationRambus Inc.Media VisionNeomagic CorporationNM2070 [MagicGraph 128]NM2090 [MagicGraph 128V]NM2093 [MagicGraph 128ZV]NM2160 [MagicGraph 128XD]NM2200 [MagicGraph 256AV]NM2360 [MagicMedia 256ZX]NM2380 [MagicMedia 256XL+]NM2230 [MagicGraph 256AV+]NM2093 [MagicGraph 128ZV+]NM2200 [MagicMedia 256AV Audio]NM2360 [MagicMedia 256ZX Audio]NM2380 [MagicMedia 256XL+ Audio]Dataexpert CorporationFujitsu Microelectr., Inc.Omron CorporationMentor ARC IncAdvanced System Products, IncASC1100ASC1200 [(abp940) Fast SCSI-II]ABP940-U / ABP960-UABP940-UWABP940-U2WRadiusCiticorp TTImb86605Fujitsu LimitedFuturePlus Systems Corp.Molex IncorporatedJabil Circuit IncHualon MicroelectronicsAutologic Inc.CetiaBCM Advanced ResearchAdvanced Peripherals LabsMacronix, Inc. [MXIC]MX98713MX987x5MX86250MX86200Compaq IPG-AustinTC4048 Token Ring 4/16Tl3c3x9Rohm LSI Systems, Inc.CERN/ECP/EDUSTAR/RD24 SCI-PCI (PMC)TAR/RD24 SCI-PCI (PMC)HIPPI destinationHIPPI sourceATT2C15-3 FPGAEvans & SutherlandnVidia CorporationNV1 [EDGE 3D]NV1 [EDGE 3D]NV2 [Mutara V08]NV4 [RIVA TNT]NV5 [RIVA TNT2/TNT2 Pro]NV5 [RIVA TNT2 Ultra]NV5 [Riva TnT2]NV5 [Riva TnT2]NV6 [Vanta/Vanta LT]NV5M64 [RIVA TNT2 Model 64/Model 64 Pro]NV6 [Vanta]NV6 [Vanta]nForce2 ISA BridgenForce2 SMBus (MCP)nForce2 IDEnForce2 Ethernet ControllernForce2 USB ControllernForce2 USB ControllernForce2 AC97 Audio Controler (MCP)nForce MultiMedia audio [Via VT82C686B]nForce2 FireWire (IEEE 1394) ControllerNV5 [Aladdin TNT2]NV10 [GeForce 256 SDR]NV10DDR [GeForce 256 DDR]NV10GL [Quadro]NV11 [GeForce2 MX/MX 400]NV11DDR [GeForce2 MX 100 DDR/200 DDR]NV11 [GeForce2 Go]NV11GL [Quadro2 MXR/EX]NV15 [GeForce2 GTS/Pro]NV15DDR [GeForce2 Ti]NV15BR [GeForce2 Ultra, Bladerunner]NV15GL [Quadro2 Pro]NV17 [GeForce4 MX 460]NV17 [GeForce4 MX 440]NV17 [GeForce4 MX 420]NV17 [GeForce4 MX 440-SE]NV17 [GeForce4 440 Go]NV17 [GeForce4 420 Go]NV17 [GeForce4 420 Go 32M]NV17GL [Quadro4 550 XGL]NV17 [GeForce4 440 Go 64M]NV17GL [Quadro4 200/400 NVS]NV17GL [Quadro4 550 XGL]NV17GL [Quadro4 550 GoGL]NV18 [GeForce4 MX 440 AGP 8x]NV18 [GeForce4 MX 440SE AGP 8x]NV18 [GeForce4 MX 420 AGP 8x]NV18GL [Quadro4 580 XGL]NV18GL [Quadro4 NVS]NV18GL [Quadro4 380 XGL]NV15 [GeForce2 - nForce GPU]nForce CPU bridgenForce 420 Memory Controller (DDR)nForce 220/420 Memory ControllernForce 220/420 Memory ControllernForce AudionForce ISA BridgenForce PCI System ManagementnForce AGP to PCI BridgenForce PCI-to-PCI bridgenForce IDEIntel 537 [nForce MC97 Modem]nForce USB ControllernForce Ethernet ControllernForce2 AGPNV18 [GeForce4 MX - nForce GPU]NV20 [GeForce3]NV20 [GeForce3 Ti 200]NV20 [GeForce3 Ti 500]NV20DCC [Quadro DCC]NV25 [GeForce4 Ti 4600]NV25 [GeForce4 Ti 4400]NV25 [GeForce4 Ti]NV25 [GeForce4 Ti 4200]NV25GL [Quadro4 900 XGL]NV25GL [Quadro4 750 XGL]NV25GL [Quadro4 700 XGL]NV28 [GeForce4 Ti 4800]NV28 [GeForce4 Ti 4200 AGP 8x]NV28 [GeForce4 Ti 4800 SE]NV28 [GeForce4 Ti 4200 Go AGP 8x]NV28GL [Quadro4 980 XGL]NV28GL [Quadro4 780 XGL]NV30 [GeForce FX]NV30 [GeForce FX 5800 Ultra]NV30 [GeForce FX 5800]NV30GL [Quadro FX 2000]NV30GL [Quadro FX 1000]Emulex CorporationLP6000 Fibre Channel Host AdapterLP850 Fibre Channel AdapterLP952 Fibre Channel AdapterLP982 Fibre Channel AdapterLP7000 Fibre Channel Host AdapterLP8000 Fibre Channel Host AdapterLP9000 Fibre Channel Host AdapterLP9802 Fibre Channel AdapterIntegrated Micro Solutions Inc.IMS5026/27/28IMS5027IMS5028IMS8849IMS8853IMS9128 [Twin turbo 128]Tekram Technology Co.,Ltd.TRM-S1040DC-690cDC-290Aptix CorporationTundra Semiconductor Corp.CA91C042 [Universe]CA91C860 [QSpan]CA91C862A [QSpan-II]Tandem ComputersMicro Industries CorporationGainbery Computer Products Inc.VademApplied Micro Circuits Corp.Q-Motion Video Capture/Edit boardS5930 [Matchmaker]S5920LANai4.x [Myrinet LANai interface chip]S5933_PARASTATIONS5933 [Matchmaker]Kongsberg Spacetec Format SynchronizerKongsberg Spacetec Serial Output BoardS5933_HEPC3PCI-9112PCI-9118PCI-9812PCI-IEEE1355-DS-DE InterfaceS5933 [Matchmaker] (Chipset Development Tool)AJA HDNTV HD SDI FramestoreAlps Electric Co., Ltd.Intergraphics SystemsIGA-1680IGA-1682IGA-1683CyberPro 2000CyberPro 2000ACyberPro 5000CyberPro 5050CyberPro 5202Artists Graphics3GATwist3 Frame GrabberRealtek Semiconductor Co., Ltd.RTL-8029(AS)RTL-8129RT8139 (B/C) Cardbus Fast Ethernet AdapterRTL-8139/8139C/8139C+RTL-8169SmartLAN56 56K ModemAscii CorporationV7310Xilinx CorporationRME Digi96RME Digi96/8RME Digi96/8 ProRME Digi96/8 PadRME Digi9652 (Hammerfall)RME Hammerfall DSPRacore Computer Products, Inc.M815x Token Ring AdapterPeritek CorporationTyan ComputerAchme Computer, Inc.Alaris, Inc.S-MOS Systems, Inc.NKK CorporationNDR4000 [NR4600 Bridge]Creative Electronic Systems SAMatsushita Electric Industrial Co., Ltd.Altos India LtdPC DirectTruevisionTARGA 1000Thesys Gesellschaft fr Mikroelektronik mbHTH 6255I-O Data Device, Inc.Cardbus IDE ControllerCardbus SCSI CBSC IISoyo Computer, IncFast Multimedia AGNCubeJazz MultimediaInitio CorporationINI-A100U2WINI-9100/9100WINI-940INI-950360PCreative LabsSB Live! EMU10k1SB Audigy[SB Live! Value] EMU10k1XSB Audigy FireWire PortSB Live! MIDI/Game PortSB Audigy MIDI/Game port[SB Live! Value] Input device controllerSB0100 [SBLive! 5.1 OEM]Ectiva EV1938Triones Technologies, Inc.HPT343HPT366/368/370/370A/372HPT372AHPT302HPT371HPT374HPT372NRasterOps Corp.Sigma Designs, Inc.REALmagic Xcard MPEG 1/2/3/4 DVD DecoderREALmagic Hollywood Plus DVD DecoderEM840x REALmagic DVD/MPEG-2 Audio/Video DecoderVIA Technologies, Inc.Embedded VIA Ethernet ControllerVT6305 1394.A ControllerVT8363/8365 [KT133/KM133]VT8371 [KX133]VT8501 [Apollo MVP4]VT82C505VT82C576MVVT82C586A/B/VT82C686/A/B/VT823x/A/C PIPC Bus Master IDEVT82C576 3V [Apollo Master]VT82C585VP [Apollo VP1/VPX]VT82C586/A/B PCI-to-ISA [Apollo VP]VT82C595 [Apollo VP2]VT82C596 ISA [Mobile South]VT82C597 [Apollo VP3]VT82C598 [Apollo MVP3]VT8601 [Apollo ProMedia]VT8605 [ProSavage PM133]VT82C680 [Apollo P6]VT82C686 [Apollo Super South]VT82C693A/694x [Apollo PRO133x]VT82C693 [Apollo Pro Plus]VT82C693A [Apollo Pro133 AGP]VT82C926 [Amazon]VT82C570MVVT82C570MVVT82C576M/VT82C586VT82C595/97 [Apollo VP2/97]USBVT82C586B ACPIVT86C100A [Rhine]IEEE 1394 Host ControllerVT82C596 Power ManagementVT82C596 Power ManagementVT82C686 [Apollo Super ACPI]VT82C686 AC97 Audio ControllerVT8233/A/8235 AC97 Audio ControllerVT6102 [Rhine-II]Intel 537 [AC97 Modem]VT8233 PCI to ISA BridgeVT8633 [Apollo Pro266]VT8366/A/7 [Apollo KT266/A/333]VT8653 Host BridgeVT8662 Host BridgeVT8615 Host BridgeUSB 2.0VT6105 [Rhine-III]VT8233C PCI to ISA BridgeVT8361 [KLE133] Host BridgeVT8375 [KM266/KL266] Host BridgeVT8623 [Apollo CLE266] integrated CastleRock graphicsVT8623 [Apollo CLE266]VT8753 [P4X266 AGP]VT3133 Host BridgeVT8233A ISA BridgeP4M266 Host BridgeP/KN266 Host BridgeVT8374 P4X400 Host Controller/AGP BridgeVT8235 ISA BridgeVT8377 [KT400 AGP] Host BridgeVT82C596 ACPI [Apollo PRO]VT85C100A [Rhine II]VT8231 [PCI-to-ISA Bridge]VT8235 ACPIVT8363/8365 [KT133/KM133 AGP]VT8371 [KX133 AGP]VT8501 [Apollo MVP4 AGP]VT82C596 [Apollo PRO AGP]VT82C597 [Apollo VP3 AGP]VT82C598/694x [Apollo MVP3/Pro133x AGP]VT8601 [Apollo ProMedia AGP]VT8605 [PM133 AGP]VT82C691 [Apollo Pro]VT82C693 [Apollo Pro Plus] PCI BridgeVT8633 [Apollo Pro266 AGP]VT8366/A/7 [Apollo KT266/A/333 AGP]VT8653 AGP BridgeVT8362 AGP BridgeVT8615 AGP BridgeVT8361 [KLE133] AGP BridgeVT8235 PCI BridgeStratus ComputersVIA VT82C570MV [Apollo] (Wrong vendor ID!)Proteon, Inc.p1690plus_AAp1690plus_ABP1690PlusP1690PlusP1690PlusP1690PlusP1690PlusP1690PlusCogent Data Technologies, Inc.EM110TX [EX110TX]Siemens Nixdorf AGPirahna 2-portTulip controller, power management, switch extenderFSC PINC (I/O-APIC)FSC Multiprocessor Interrupt ControllerFSC Copernicus Management ControllerFSC Remote Service Controller, mailbox deviceFSC Remote Service Controller, shared memory deviceFSC Remote Service Controller, SMIC deviceDSCC4 WAN adapterFPGA I-Bus Tracer for MBDSZB6120Chromatic Research Inc.Mpact Media ProcessorMpact 2Mini-Max Technology, Inc.Znyx Advanced SystemsCPU TechnologyRoss TechnologyPowerhouse SystemsFirepower Powerized SMP I/O ASICFirepower Powerized SMP I/O ASICSanta Cruz OperationOsicom Technologies IncFDDI AdapterFast Ethernet Adapter4 Port Fast Ethernet AdapterATM AdapterAccton Technology CorporationSMC2-1211TXEN-1216 Ethernet AdapterEN-1217 Ethernet Adapter10Mbps Network cardEN-1207D Fast Ethernet AdapterFast Ethernet AdapterAtmel Corporation3D LabsData TranslationDT3001DT3002DT3003DT3004DT3005DT3001-PGLDT3003-PGLDatacube, IncMax-1C SVGA cardMax-1C image processingBerg ElectronicsICP Vortex Computersysteme GmbHGDT 6000/6020/6050GDT 6000B/6010GDT 6110/6510GDT 6120/6520GDT 6530GDT 6550GDT 6x17GDT 6x27GDT 6537GDT 6557GDT 6115/6515GDT 6125/6525GDT 6535GDT 6555GDT 6117RP/6517RPGDT 6127RP/6527RPGDT 6537RPGDT 6557RPGDT 6111RP/6511RPGDT 6121RP/6521RPGDT 6117RD/6517RDGDT 6127RD/6527RDGDT 6537RDGDT 6557RDGDT 6111RD/6511RDGDT 6121RD/6521RDGDT 6118RD/6518RD/6618RDGDT 6128RD/6528RD/6628RDGDT 6538RD/6638RDGDT 6558RD/6658RDGDT 6117RP2/6517RP2GDT 6127RP2/6527RP2GDT 6537RP2GDT 6557RP2GDT 6111RP2/6511RP2GDT 6121RP2/6521RP2GDT 6113RS/6513RSGDT 6123RS/6523RSGDT 6118RS/6518RS/6618RSGDT 6128RS/6528RS/6628RSGDT 6538RS/6638RSGDT 6558RS/6658RSGDT 6533RS/6633RSGDT 6543RS/6643RSGDT 6553RS/6653RSGDT 6563RS/6663RSGDT 7113RN/7513RN/7613RNGDT 7123RN/7523RN/7623RNGDT 7118RN/7518RN/7518RNGDT 7128RN/7528RN/7628RNGDT 7538RN/7638RNGDT 7558RN/7658RNGDT 7533RN/7633RNGDT 7543RN/7643RNGDT 7553RN/7653RNGDT 7563RN/7663RNGDT 4x13RZGDT 4x23RZGDT 8x13RZGDT 8x23RZGDT 8x33RZGDT 8x43RZGDT 8x53RZGDT 8x63RZGDT 6519RD/6619RDGDT 6529RD/6629RDGDT 7519RN/7619RNGDT 7529RN/7629RNGDT Raid ControllerEfficient Networks, Inc155P-MF1 (FPGA)155P-MF1 (ASIC)ENI-25P ATMSpeedStream (LANAI)SpeedStream ADSLTeledyne Electronic SystemsTricord Systems Inc.Powerbis BridgeIntegrated Device TechIDT77211 ATM AdapterIDT77252 ATM network controllerEldecPrecision Digital ImagesPrecision MX Video engine interfaceFrame capture bus interfaceEMC CorporationZilogMulti-tech Systems, Inc.Excellent Design, Inc.Leutron Vision AGEurocoreVigraFORE Systems IncForeRunner PCA-200 ATMPCA-200PCATMForeRunner PCA-200EPC ATMATMForeRunnerHE ATM AdapterFirmworksHermes Electronics Company, Ltd.Linotype - Hell AGZenith Data SystemsRavicadInfomedia Microelectronics Inc.Imaging Technology IncMVC IC-PCIMVC IM-PCI Video frame grabber/processorComputervisionPhilips SemiconductorsUSB 1.1 Host ControllerUSB 2.0 Host ControllerSmartPCI56(UCB1500) 56K ModemSAA7130 Video Broadcast DecoderSAA7133 Audio+video broadcast decoderSAA7134SAA7135 Audio+video broadcast decoderSAA7145SAA7146Mitel Corp.Eicon Technology CorporationEiconCard S90EiconCard S90EiconCard S91EiconCard S91EiconCard S94EiconCard S94EiconCard S94EiconCard S94EiconCard P92EiconCard P92EiconCard P92DIVA 20PRODIVA 20DIVA 20PRO_UDIVA 20_UDIVA LOWDIVA 2.02DIVA Server BRI-2MDIVA Server BRI-8MDIVA Server PRI-30MDIVA Server BRI-2M/-2FMercury Computer SystemsRaceway BridgeFuji Xerox Co LtdPrinter controllerMomentum Data SystemsCisco Systems IncZiatech Corporation8905 [STD 32 Bridge]Dynamic Pictures, IncVGA Compatable 3D GraphicsFWB IncNetwork Computing DevicesCyclone Microsystems, Inc.PCI-9060 i960 BridgePCI-SDK [PCI i960 Evaluation Platform]PCI-911 [i960Jx-based Intelligent I/O Controller]PCI-912 [i960CF-based Intelligent I/O Controller]PCI-913PCI-914 [I/O Controller w/ secondary PCI bus]Leading Edge Products IncSanyo Electric Co - Computer Engineering DeptEquinox Systems, Inc.SST-64P AdapterSST-128P AdapterSST-16P DB AdapterSST-16P RJ AdapterSST-16P AdapterSST-4P AdapterSST-8P AdapterIntervoice IncCrest Microsystem IncAlliance Semiconductor CorporationAP6410ProVideo 6422ProVideo 6424ProMotion AT25ProMotion AT3DNetPower, IncCincinnati MilacronNoservo controllerWorkbit CorporationNinjaSCSI-32 WorkbitNinjaSCSI-32 KMENinjaSCSI-32 WorkbitNinjaSCSI-32 LogitecNinjaSCSI-32 LogitecNinjaSCSI-32 MelcoForce ComputersInterface CorpSyskonnect (Schneider & Koch)FDDI AdapterToken Ring adapterSK-98xx Gigabit Ethernet Server AdapterSK-98xx V2.0 Gigabit Ethernet AdapterWin System CorporationVMICVMIPCI-5579 (Reflective Memory Card)VMIPCI-5587 (Reflective Memory Card)VMIC PCI 7755 FPGAVMIVME-7587Canopus Co., LtdAnnabooksIC CorporationNikon Systems IncDigi InternationalAccelePort EPCRightSwitch SE-6AccelePort XemAccelePort XrAccelePort Xr,C/XAccelePort Xr/JAccelePort EPC/JDataFirePRIme T1 (1-port)SyncPort 2-Port (x.25/FR)AccelePort 8r EIA-232 (IBM)AccelePort 8r EIA-422AccelePort XrAccelePort 8r EIA-422AccelePort XemAccelePort EPC/XAccelePort C/XDataFirePRIme E1 (1-port)AccelePort C/X (IBM)DataFire RAS T1/E1/PRIAccelePort RASDataFire RAS B4 ST/UAccelePort 4r 920AccelePort Xr 920AccelePort 2r 920DataFire DSP T1/E1/PRI cPCIAccelePort XpAccelePort 2p PCIDatafire Micro V IOM2 (Europe)Datafire Micro V (Europe)Datafire Micro V IOM2 (North America)Datafire Micro V (North America)AvanstarThinking Machines CorpJAE Electronics Inc.MegatekLand Win Electronic CorpMelco IncPine Technology LtdPeriscope EngineeringAvsys CorporationVoarx R & D IncTokenet/vg 1001/10m anylanLanfleet/TruevalueLanfleet/TruevalueMutech CorpMV-1000Harlequin LtdParallax GraphicsPhotron Ltd.XircomCardbus Ethernet 10/100Cardbus Ethernet 10/100Cardbus Ethernet 10/100Cardbus Ethernet 10/100Mini-PCI V.90 56k ModemCardbus Ethernet 10/100Cardbus 56k modemCardbus Ethernet + 56k ModemPeer Protocols IncMaxtor CorporationMegasoft IncPFU LimitedOA Laboratory Co LtdRenditionVerite 1000Verite V2000/V2100/V2200Advanced Peripherals TechnologiesImagraph CorporationMotion TPEG Recorder/Player with audioServerWorksCNB20-LE Host BridgeCNB20HE Host BridgeCNB20-LE Host BridgeCNB20HE Host BridgeCNB20LE Host BridgeCIOB30CMIC-HECMIC-LECNB20-HE Host BridgeCNB20-HE Host BridgeCMIC-GC Host BridgeCMIC-GC Host BridgeGCNB-LE Host BridgeOSB4 South BridgeCSB5 South BridgeCSB6 South BridgeOSB4 IDE ControllerCSB5 IDE ControllerCSB6 RAID/IDE ControllerOSB4/CSB5 OHCI USB ControllerCSB6 OHCI USB ControllerGCLE Host BridgeGCLE-2 Host BridgeMutoh Industries IncThine Electronics IncCentre for Development of Advanced ComputingPolaris CommunicationsBus/Tag ChannelEscon ChannelBus/Tag ChannelEscon ChannelConnectware IncIntelligent Resources Integrated SystemsMartin-MariettaElectronics for ImagingWorkstation TechnologyInventec CorporationLoughborough Sound Images PlcAltera CorporationAdobe Systems, IncBridgeport MachinesMitron Computer Inc.SBE IncorporatedSilicon EngineeringAlfa, Inc.Fast Ethernet AdapterToshiba America Info SystemsEX-IDE Type-BDVD Decoder cardTecra Video Capture deviceDVD Decoder card (Version 2)601ToPIC95 PCI to CardBus Bridge for NotebooksToPIC95ToPIC97ToPIC95 PCI to Cardbus Bridge with ZV SupportCPU to PCI and PCI to ISA bridgeFIR PortTC6371AF SmartMedia ControllerSD TypA ControllerFIR Port Type-DOA-Trend TechnologyL G Electronics, Inc.Atto TechnologyBecton & DickinsonT/R SystemsIntegrated Circuit SystemsRicoh Co LtdRL5c465RL5c466RL5c475RL5c476 IIRL5c477RL5c478R5C522 IEEE 1394 ControllerR5C551 IEEE 1394 ControllerR5C552 IEEE 1394 ControllerTelmatics InternationalFujikura LtdForks IncDataworld International LtdD-Link System IncDC21041DL10050 Sundance EthernetRTL8139 EthernetDFE-690TXD CardBus PC CardDRP-32TXD Cardbus PC CardDL2K EthernetGigabit Ethernet AdapterAdvanced Technology Laboratories, Inc.Shima Seiki Manufacturing Ltd.Matsushita Electronics Co LtdHilevel TechnologyHypertec Pty LimitedCorollary, IncPCIB [C-bus II to PCI bus host bridge chip]Intel 8-way XEON Profusion Chipset [Cache Coherency Filter]BitFlow IncRaptor-PCI framegrabberModel 12 Road Runner Frame GrabberModel 14 Road Runner Frame GrabberModel 24 Road Runner Frame GrabberModel 44 Road Runner Frame GrabberModel 12 Road Runner Frame GrabberModel 14 Road Runner Frame GrabberModel 24 Road Runner Frame GrabberModel 44 Road Runner Frame GrabberModel 12 Road Runner Frame GrabberModel 14 Road Runner Frame GrabberModel 24 Road Runner Frame GrabberModel 44 Road Runner Frame GrabberModel 12 Road Runner Frame GrabberModel 14 Road Runner Frame GrabberModel 24 Road Runner Frame GrabberModel 44 Road Runner Frame GrabberHermstedt GmbHGreen LogicTripaceTP-910/920/940 PCI Ultra(Wide) SCSI AdapterArtop Electronic CorpSCSI Cache Host AdapterATP8400ATP850UFATP860 NO-BIOSATP860ATP865 NO-ROMATP865AEC6710 SCSI-2 Host AdapterAEC6712UW SCSIAEC6712U SCSIAEC6712S SCSIAEC6712D SCSIAEC6712SUW SCSIDensan Company LtdZeitnet Inc.12211225Toucan TechnologyRatoc System IncHytec Electronics LtdGage Applied Sciences, Inc.Lambda Systems IncAttachmate CorporationMind Share, Inc.Omega Micro Inc.82C092GInformation Technology Inst.Bug, Inc. Sapporo JapanFujitsu Microelectronics Ltd.FireStream 155FireStream 50Bull HN Information SystemsConvex Computer CorporationHamamatsu Photonics K.K.Sierra Research and TechnologyDeuretzbacher GmbH & Co. Eng. KGBarco Graphics NVMicrounity Systems Eng. IncPure Data Ltd.Power Computing Corp.Systech Corp.InnoSys Inc.AMCC S933Q Intelligent Serial CardActelGalileo Technology Ltd.GT-64010/64010A System ControllerGT-64011/GT-64111 System ControllerGigabit Ethernet AdapterGT-64115 System ControllerGT-64120/64120A/64121A System ControllerGT-48001GT-64010 Primary Image Piranha Image GeneratorCanon Information Systems Research Aust.Lite-On Communications IncLNE100TXLNE100TX [Linksys EtherFast 10/100]Aztech System LtdAvid Technology Inc.V3 Semiconductor Inc.V300PSCV292PBC [Am29030/40 Bridge]V96xPBCV96DPCApricot ComputersEastman KodakBarr Systems Inc.Leitch Technology InternationalRadstone Technology PlcUnited Video CorpMotorolaXPoint Technologies, IncQuad PeerMasterPathlight Technology Inc.SSA ControllerVideotron CorpPyramid TechnologyNetwork Peripherals IncNP-PCIPinnacle Systems Inc.International Microcircuits IncAstrodesign, Inc.Hewlett PackardLucent Microelectronics56k WinModem56k WinModem56k WinModemLT WinModemLT WinModemLT WinModemLT WinModemLT WinModemWinModem 56kWinModem 56kF-1156IV WinModem (V90, 56KFlex)LT WinModemLT WinModemLT WinModemLT WinModemV90 WildWire ModemLT WinModemLT WinModemLT WinModemLT WinModemLT WinModemLT WinModemLT WinModemLT WinModemLT WinModemLT WinModemLT WinModemLT WinModemV90 WildWire ModemV90 WildWire ModemVenus Modem (V90, 56KFlex)USBUSS-312 USB ControllerUSS-344S USB ControllerFW323Sand MicroelectronicsNEC CorporationDocument Technologies, IncShiva CorporationDainippon Screen Mfg. Co. LtdD.C.M. Data SystemsDolphin Interconnect Solutions ASPSB32 SCI-Adapter D31xPSB64 SCI-Adapter D32xPSB66 SCI-Adapter D33xMagma16-line serial port w/- DMA4-line serial port w/- DMALSI Systems, IncSpecialix Research Ltd.PCI_9050SUPI_1T225Michels & Kleberhoff Computer GmbHHAL Computer Systems, Inc.NetaccessPioneer Electronic CorporationLockheed Martin Federal Systems-ManassasAuravisionVxP524Intercom Inc.Trancell Systems IncAnalog DevicesSM56 PCI modemAD1889 sound chipIkon Corporation1011510117Tekelec TelecomTrenton Technology, Inc.Image Technologies DevelopmentTEC CorporationNovellSega Enterprises LtdQuestra CorporationCrosfield Electronics LimitedZoran CorporationZR36057PQC Video cutting chipsetZR36120New Wave PDGCray Communications A/SGEC Plessey Semi Inc.Samsung Information Systems AmericaQuicklogic CorporationPC WatchdogSecond Wave IncIIX ConsultingMitsui-Zosen System ResearchToshiba America, Elec. CompanyDigital Processing Systems Inc.Highwater Designs Ltd.Elsag BaileyFormation Inc.Coreco IncMediamaticsDome Imaging Systems IncNicolet Technologies B.V.Compu-ShackFDDIFASTline UTP QuattroFASTline FOFASTline UTPFASTline-II UTPFASTline-II FOGIGAlineSymbios Logic IncPicture Tel Japan K.K.Keithley MetrabyteKinetic Systems CorporationCAMAC controllerComputing Devices InternationalCompexENet100VG4FreedomLine 100ReadyLink 2000RL100-ATX 10/100ReadyLink 100TX (Winbond W89C840)RL100TXScientific AtlantaPMC-Sierra Inc.PM7375 [LASAR-155 ATM SAR]I-Cube IncKasan Electronics Company, Ltd.Datel IncSilicon MagicHigh Street ConsultantsComtrol CorporationRocketPort 8 OctRocketPort 8 IntfRocketPort 16 IntfRocketPort 32 IntfRocketPort OctacableRocketPort 8JRocketPort 4-portRocketPort 8-portRocketPort 16-portRocketPort Plus QuadcableRocketPort Plus OctacableRocketPort 8-port ModemRocketPort 4-port UART 16954Scion CorporationCSS CorporationVista Controls CorpNetwork General Corp.Gigabit Ethernet AdapterBayer Corporation, Agfa DivisionLattice Semiconductor CorporationArray CorporationAmdahl CorporationParsytec GmbHHS-Link DeviceSCI Systems IncSynaptelAdaptive SolutionsTechnical Corp.Compression Labs, Inc.Cyclades CorporationCyclom-Y below first megabyteCyclom-Y above first megabyteCyclom-4Y below first megabyteCyclom-4Y above first megabyteCyclom-8Y below first megabyteCyclom-8Y above first megabyteCyclades-Z below first megabyteCyclades-Z above first megabytePC300/RSV or /X21 (2 ports)PC300/RSV or /X21 (1 port)PC300/TE (2 ports)PC300/TE (1 port)PC300/TE-M (2 ports)PC300/TE-M (1 port)PC400Essential CommunicationsRoadrunner serial HIPPIHyperparallel TechnologiesBraintech IncKingston Technology Corp.Applied Intelligent Systems, Inc.Performance Technologies, Inc.Interware Co., LtdPurup Prepress A/SO2 Micro, Inc.OZ6729OZ6730OZ6832/6833 Cardbus ControllerOZ6836/6860 Cardbus ControllerOZ6812 Cardbus ControllerOZ6922 Cardbus ControllerOZ6933 Cardbus ControllerOZ6912 Cardbus ControllerHybricon Corp.First Virtual Corporation3Dfx Interactive, Inc.VoodooVoodoo 2Voodoo BansheeVoodoo Banshee [Velocity 100]Voodoo 3Voodoo 4 / Voodoo 5Voodoo 3/3000 [Avenger]Advanced Telecommunications ModulesNippon Texaco., LtdLippert Automationstechnik GmbHCSPIArcus Technology, Inc.Ariel CorporationAMCC 5933 TMS320C80 DSP/Imaging boardContec Co., LtdAncor Communications, Inc.Artesyn Communication ProductsPM/LinkPM/T1PM/E1PM/SLSBajaSpan Resource TargetBajaSpan Section 0BajaSpan Section 1BajaSpan Section 2BajaSpan Section 3PM/PPCInteractive ImagesPower I/O, Inc.Tech-SourceNorsk Elektro Optikk A/SData Kinesis Inc.Integrated TelecomLG Industrial Systems Co., LtdSican GmbHAztech System Ltd368DSP3328 Audio3328 AudioXyratexAndrew CorporationFishcamp EngineeringWoodward McCoach, Inc.GPT LimitedBus-Tech, Inc.Technical Corp.Risq Modular Systems, Inc.Sigma Designs CorporationRealMagic64/GXREALmagic 64/GX (SD 6425)Alta Technology CorporationAdtran3DO CompanyVisicom Laboratories, Inc.Seeq Technology, Inc.Century Systems, Inc.Engineering Design Team, Inc.EasyConnect 8/32EasyConnect 8/64EasyIOSimutech, Inc.C-Cube MicrosystemsMPEGE4?Cinemaster C 3.0 DVD DecoderMarathon Technologies Corp.DSC CommunicationsJaycor Networks, Inc.JNI Corporation (former Jaycor Networks, Inc.)FCI-1063 Fibre Channel AdapterFCX2-6562 Dual Channel PCI-X Fibre Channel AdapterFCX-6562 PCI-X Fibre Channel AdapterDelphaxAVM Audiovisuelles MKTG & Computer System GmbHB1 ISDNC4 ISDNA1 ISDN [Fritz]Fritz!PCI v2.0 ISDNC2 ISDNT1 ISDNA.P.D., S.A.Dipix Technologies, Inc.Xylon Research, Inc.Central Data CorporationSamsung Electronics Co., Ltd.AEG Electrocom GmbHSBS/Greenspring Modular I/OPCI-40A or cPCI-200 Quad IndustryPack carrierSolitron Technologies, Inc.Stallion Technologies, Inc.EasyConnection 8/32EasyConnection 8/64EasyIOEasyConnection/RACylinkInfotrend Technology, Inc.IFT-2000 Series RAID ControllerHitachi Microcomputer System LtdVLSI Solutions OyGuzik Technical EnterprisesLinear Systems Ltd.Optibase LtdMPEG ForgeMPEG FusionVideoPlexVideoPlex CCVideoQuestPerceptive Solutions, Inc.PCI-2220IPCI-2240IPCI-2000Vertex Networks, Inc.Gilbarco, Inc.Allied Telesyn InternationalAT-2560 Fast Ethernet Adapter (i82557B)ABB Power SystemsAsix Electronics CorporationALFA GFC2204Aurora Technologies, Inc.Aries 16000PESS TechnologyES336H Fax Modem (Early Model)Solo?ES1968 Maestro 2ES1969 Solo-1 AudiodriveES1978 Maestro 2EES1988 Allegro-1ESS ModemES1983S Maestro-3i PCI Audio AcceleratorES1983S Maestro-3i PCI Modem AcceleratorES1983S Maestro-3i PCI Audio AcceleratorES1983S Maestro-3i PCI Modem AcceleratorES336H Fax Modem (Later Model)ES2838/2839 SuperLink ModemES2898 ModemSpecialvideo Engineering SRLConcurrent Technologies, Inc.Harris SemiconductorPrism 2.5 Wavelan chipsetD-Links DWL-g650 A1HMP8130 NTSC/PAL Video DecoderHMP8131 NTSC/PAL Video DecoderMatsushita-Kotobuki Electronics Industries, Ltd.ES Computer Company, Ltd.Sonic SolutionsAval Nagasaki CorporationCasio Computer Co., Ltd.Microdyne CorporationNE10/100 Adapter (i82557B)NE2000Plus (RT8029) Ethernet AdapterS. A. TelecommunicationsPCR2101Telsat TurboTektronixThomson-CSF/TTMLexmark International, Inc.Adax, Inc.Northern TelecomSplash Technology, Inc.Sumitomo Metal Industries, Ltd.Silicon Motion, Inc.SM710 LynxEMSM712 LynxEM+SM720 Lynx3DMSM810 LynxESM811 LynxESM820 Lynx3DSM910Olympus Optical Co., Ltd.GW InstrumentsTelematics InternationalHughes Network SystemsDirecPCEnsoniqES1373 [AudioPCI] (also Creative Labs CT5803)ES1371 [AudioPCI-97]ES1370 [AudioPCI]5880 AudioPCINetwork Appliance CorporationSwitched Network Technologies, Inc.ComstreamTranstech Parallel Systems Ltd.TPE3/TM3 PowerPC NodeTPE5 PowerPC PCI boardTransmeta CorporationNorthbridgeLongRun NorthbridgeSDRAM controllerBIOS scratchpadRockwell InternationalHCF 56k Data/Fax ModemHCF 56k Data/Fax ModemHCF 56k Data/Fax/Voice ModemHCF 56k Data/Fax/Voice/Spkp (w/Handset) ModemHCF 56k ModemHCF 56k Data/Fax ModemHCF 56k Data/Fax/Voice ModemHCF 56k Data/Fax/Voice/Spkp (w/Handset) ModemHCF 56k PCI Speakerphone ModemHCF 56k ModemHCF 56k ModemHCF 56k ModemHCF 56k PCI Speakerphone ModemHCF 56k ModemHCF 56k Volcano PCI ModemHCF 56k Data/Fax ModemHSF 56k Data/Fax ModemHSF 56k Data/Fax/Voice ModemHSF 56k Data/Fax/Voice/Spkp (w/Handset) ModemHSF 56k Data/Fax/Voice/Spkp ModemRiptide HSF 56k PCI ModemRiptide PCI Audio ControllerRiptide HCF 56k PCI ModemRiptide PCI Game ControllerRapidFire 616X ATM155 AdapterPixera CorporationCrosspoint Solutions, Inc.Vela ResearchWinnov, L.P.FujifilmPhotoscript Group Ltd.Yokogawa Electric CorporationDavicom Semiconductor, Inc.Ethernet 100/10 MBitEthernet 100/10 MBitEthernet 100/10 MBitEthernet 100/10 MBitIntegrated Technology Express, Inc.IT8330GIT8181E/F LCD/VGA ControllerIT8330GIT8888F PCI to ISA Bridge with SMBIT8889F PCI to ISA BridgeIT8330GSahara Networks, Inc.Platform Technologies, Inc.AGOGO sound chip (aka ESS Maestro 1)Mazet GmbHM-Pact, Inc.LS220D DVD DecoderLS220C DVD DecoderTimestep CorporationAVC Technology, Inc.Asante Technologies, Inc.Transwitch CorporationRetix CorporationG2 Networks, Inc.ATM155 AdapterHoontech Corporation/Samho Multi Tech Ltd.ST128 WSS/SBST128 SAM9407ST128 Game PortST128 MPU PortST128 Ctrl PortTateno Dennou, Inc.Sord Computer CorporationNCS Computer ItaliaTritech Microelectronics IncMedia Reality TechnologyRhetorex, Inc.Imagenation CorporationKofax Image ProductsHolco Enterprise Co, Ltd/Shuttle ComputerSpellcaster Telecommunications Inc.Knowledge Technology Lab.VMetro, inc.PBT-615 PCI-X Bus AnalyzerImage AccessJaycorCompcore Multimedia, Inc.Victor Company of Japan, Ltd.OEC Medical Systems, Inc.Allen-Bradley CompanySimpact Associates, Inc.Newgen Systems CorporationLucent TechnologiesNTT Electronics Technology CompanyVision Dynamics Ltd.Scalable Networks, Inc.AMO GmbHNews DatacomXiotech CorporationSDL Communications, Inc.Yuan Yuan Enterprise Co., Ltd.MPG-200C PCI DVD Decoder CardMeasurex CorporationMultidata GmbHAlteon Networks Inc.AceNIC Gigabit EthernetAceNIC Gigabit Ethernet (Copper)TDK USA CorpJorge Scientific CorpGammaLinkGeneral Signal NetworksInter-Face Co LtdFutureTel IncGranite Systems Inc.Natural MicrosystemsCognex Modular Vision Systems Div. - Acumen Inc.KorgUS Robotics/3ComWinModemUSR 56k Internal WinModem56K FaxModem Model 5610BittWare, Inc.Nippon Unisoft CorporationArray MicrosystemsComputerm Corp.Anchor Chips Inc.AN3041Q CO-MEMAN3042Q CO-MEM LiteFujifilm MicrodevicesInfimedGMM Research CorpMentec LimitedHoltek Microelectronics IncPCI NE2K EthernetPCI NE2K EthernetConnect Tech IncPicture Elements IncorporatedImaging/Scanning Subsystem EngineImaging/Scanning Subsystem EnginePCIVST [Grayscale Thresholding Engine]Video Simulator/SenderTHR2 Multi-scale ThresholderMitani CorporationDialogic CorpG Force Co, LtdGigi OperationsIntegrated Computing EnginesAntex Electronics CorporationPluto Technologies InternationalAims LabNetspeed Inc.Prophet Systems, Inc.GDE Systems, Inc.PSITechNVidia / SGS Thomson (Joint Venture)NV1DAC64Riva128Riva128ZXTNTTNT2UTNT2VTNT2ITNT2Vingmed Sound A/SUlticom (Formerly DGM&S)T1 CardEquator TechnologiesAnalogic CorpBiotronic SRLPericom SemiconductorAculab PLCPCI ProsodycPCI ProsodyTrue Time Inc.Annapolis Micro Systems, IncSymicron Computer Communication Ltd.Management GraphicsRainbow TechnologiesSBS Technologies IncChase ResearchST16C654 Quad UARTST16C654 Quad UARTST16C654 Quad UARTNintendo Co, LtdDatum Inc. Bancomm-Timing DivisionImation Corp - Medical Imaging SystemsBrooktrout Technology IncApex Semiconductor IncCirel SystemsSunsgroup CorporationCrisc CorpGE SpacenetZukenAureal SemiconductorVortex 1Vortex 2AU8810 Vortex Digital Audio ProcessorVortex 56k Software Modem3A International, Inc.Optivision Inc.Orange MicroVienna SystemsPentekSorenson Vision IncGammagraphx, Inc.Radstone TechnologyMegatelForksDawson FranceCognexElectronic Design GmbHVideoMakerFour Fold LtdSpectrum Signal ProcessingCapital Equipment CorpI2SESD Electronic System Design GmbHLexiconHarman International Industries IncComputer Sciences CorpInnovative IntegrationJuniper NetworksNetphone, IncDuet TechnologiesComputer BoardsPCI-DAS1602/16PCI-DIO48HPCI-PDISO8PCI-PDISO16PCI-DAS1200PCI-DAS1602/12PCI-DIO24HPCI-DIO24H/CTR3PCI-DIO48H/CTR15PCI-DIO96HPCI-CTR05PCI-DAS1200/JRPCI-DAS1001PCI-DAS1002PCI-DAS1602JR/16PCI-DAS6402/16PCI-DAS6402/12PCI-DAS16/M1PCI-DDA02/12PCI-DDA04/12PCI-DDA08/12PCI-DDA02/16PCI-DDA04/16PCI-DDA08/16PCI-DAC04/12-HSPCI-DAC04/16-HSPCI-DIO24PCI-DAS08PCI-INT32PCI-DUAL-AC5PCI-DAS-TCPCI-DAS64/M1/16PCI-DAS64/M2/16PCI-DAS64/M3/16PCI-DAS1000PCI-QUAD04Jato Technologies Inc.NetCelerator AdapterAB Semiconductor LtdMitsubishi Electric MicrocomputerColorgraphic Communications CorpAmbex Technologies, IncAccelerix IncYamatake-Honeywell Co. LtdAdvanet IncGespacVideoserver, IncAcuity Imaging, IncYaskawa Electric Co.Teradyne IncLinksysFast Ethernet 10/100Network Everywhere Fast Ethernet 10/100 model NC100Fast Ethernet 10/100Packet Engines Inc.PCI Ethernet AdapterFortemedia, IncXwave QS3000A [FM801]Xwave QS3000A [FM801 game port]FM801 PCI AudioFM801 PCI JoystickFinisar Corp.Nippon Electro-Sensory Devices CorpSysmic, Inc.Xinex Networks IncSiig IncCyberSerial (1-port) 16550CyberSerial (1-port) 16650CyberSerial (1-port) 16850Duet 1S(16550)+1PDuet 1S(16650)+1PDuet 1S(16850)+1PCyberParallel (1-port)CyberParallel (2-port)CyberSerial (2-port) 16550CyberSerial (2-port) 16650CyberSerial (2-port) 16850Trio 2S(16550)+1PTrio 2S(16650)+1PTrio 2S(16850)+1PCyberSerial (4-port) 16550CyberSerial (4-port) 16650CyberSerial (4-port) 16850CyberSerial (1-port) 16550CyberSerial (1-port) 16650CyberSerial (1-port) 16850Duet 1S(16550)+1PDuet 1S(16650)+1PDuet 1S(16850)+1PCyberParallel (1-port)CyberParallel (2-port)CyberSerial (2-port) 16550CyberSerial (2-port) 16650CyberSerial (2-port) 16850Trio 1S(16550)+2PTrio 1S(16650)+2PTrio 1S(16850)+2PCyberSerial (4-port) 16550CyberSerial (4-port) 16650CyberSerial (4-port) 16850Trio 2S(16550)+1PTrio 2S(16650)+1PTrio 2S(16850)+1PCrypto AGArcobel Graphics BVMTT Co., LtdDome IncSphere CommunicationsSalix Technologies, IncSeachange internationalVoss scientificquadrant internationalProductivity EnhancementMicrocom Inc.Broadband TechnologiesMicrel IncIntegrated Silicon Solution, Inc.MMC NetworksRadisys Corp.Micro MemoryMM-5415CN PCI Memory Module with Battery BackupMM-5425CN PCI 64/66 Memory Module with Battery BackupRedcreek Communications, IncVideomail, IncThird Planet PublishingBT ElectronicsVtel CorpSoftcom MicrosystemsHolontech CorpSS TechnologiesVirtual Computer CorpSCM MicrosystemsAtalla CorpKyoto Microcomputer CoPromax Systems IncPhylon Communications IncCrucial TechnologyArescom IncOdeticsSumitomo Electric Industries, Ltd.DTC Technology Corp.Domex 536Domex DMX3194UP SCSI AdapterARK Research Corp.Chori Joho System Co. LtdPCTel IncHSP MicroModem 56HSP MicroModem 56HSP MicroModem 56HSP MicroModem 56HSP MicroModem 56HSP MicroModem 56HSP MicroModem 56HSP MicroModem 56CSTIAlgo System Co LtdSystec Co. LtdSonix IncThales IdatysProserverPCI-FUTPCI-S0PCI-FUT-S0Dwave System IncKratos Analytical LtdThe Logical CoPrisa NetworksBrain BoxesGiganet IncQuatech IncQSC-100DSC-100DSC-200/300QSC-200/300ESC-100DESC-100MMPAC-100 Syncronous Serial Card (Zilog 85230)QSCLP-100DSCLP-100SSCLP-100QSCLP-200/300DSCLP-200/300SSCLP-200/300ABB Network Partner ABSealevel Systems IncSingle Port RS-232/422/485/530Dual Port RS-232/422/485 InterfaceDual Port RS-232 InterfaceFour Port RS-232 InterfaceFour Port RS-422/485 InterfaceEight Port RS-232 Interface8001 Digital I/O AdapterI-Data International A-SMeinberg FunkuhrenSoliton Systems K.K.Fujifacom CorporationPhoenix Technology LtdATM Communications IncHypercope GmbHTeijin Seiki Co. LtdHitachi Zosen CorporationSkyware CorporationDigigramHigh Soft TechKawasaki Steel CorporationAdtek System Science Co LtdGigalabs IncApplied Magic IncATL ProductsCNet Technology IncGigaCard Network AdapterSilicon Vision IncSilicom LtdArgosystems IncLMCElectronic Equipment Production & Distribution GmbHTelemann Co. LtdAsahi Kasei Microsystems Co LtdMark of the Unicorn IncPPT VisionIwatsu Electric Co LtdDynachip CorporationPatriot Scientific CorporationJapan Satellite Systems IncSanritz Automation Co LtdBrains Co. LtdMarian - Electronic & SoftwareControlnet IncReality Simulation Systems IncNetgear802.11b Wireless Adapter (MA301)MA311 802.11b wireless adapterGA620GA622GA630FA311Video Domain TechnologiesSystran CorpHitachi Information Technology Co LtdApplicom InternationalPCI1500PFB [Intelligent fieldbus adaptor]Fusion Micromedia CorpTokimec IncSilicon RealityFuture Techno Designs pte LtdBasler GmbHPatapsco Designs IncConcept Development IncDevelopment Concepts IncMedialight IncMoxa Technologies Co LtdSmartio C104H/PCISmartio C168H/PCIIntellio CP-204JIntellio C218 Turbo PCIIntellio C320 Turbo PCILevel One CommunicationsLXT1001 Gigabit EthernetAmbicom IncCipher Systems IncCologne Chip Designs GmbHISDN network controller [HFC-PCI]Clarion co. LtdRios systems Co LtdAlacritech IncQuad Port 10/100 Server AcceleratorSingle Port 10/100 Server AcceleratorSingle Port Gigabit Server AcceleratorMediasonic Multimedia Systems LtdQuantum 3d IncEPL limitedMedia4Aethra s.r.l.Crystal Group IncKawasaki Heavy Industries LtdOsitech Communications IncHifn Inc.7751 Security Processor6500 Public Key Processor7811 Security Processor7951 Security Processor78XX Security Processor8065 Security Processor8165 Security Processor8154 Security ProcessorRascom IncAudio Digital Imaging IncVideonics IncTeles AGExar Corp.XR17C158 Octal UARTSiemens Medical Systems, Ultrasound GroupBroadband Networks IncArcom Control Systems LtdMotion Media Technology LtdNexus IncALD Technology LtdT.SqwareMaxspeed CorpTamura corporationTechno Chips Co. LtdLanart CorporationWellbean Co IncARMDlog GmbHLogic Devices IncNokia Telecommunications oyElecom Co LtdOxford InstrumentsSanyo Technosound Co LtdBitran CorporationSharp corporationMiroku Jyoho Service Co. LtdSharewave IncMicrogate CorporationSyncLink WAN Adapter3ware Inc3ware ATA-RAID3ware 7000-series ATA-RAID3ware ATA-RAIDTechnotrend Systemtechnik GmbHJanz Computer AGPhase MetricsAlphi Technology CorpCondor Engineering IncBlue Chip Technology LtdApptech IncEaton CorporationIomega CorporationYano Electric Co LtdMetheus CorporationCompatible Systems CorporationCocom A/SStudio Audio & Video LtdTechsan Electronics Co LtdB2C2 Sky2PC PCI [SkyStar2]Abocom Systems IncADMtek Centaur-C rev 17RTL8139Shark Multimedia IncIMC NetworksGraphics Microsystems IncMedia 100 IncK.I. Technology Co LtdToshiba Engineering CorporationPhobos corporationApex PC Solutions IncIntresource Systems pte LtdJanich & Klass Computertechnik GmbHNetboost CorporationMultimedia Bundle IncABB Robotics Products ABE-Tech IncPCI56RVP ModemGVC CorporationSilicom Multimedia Systems IncDynamics Research CorporationNest IncCalculex IncTelesoft Design LtdArgosy research IncNAC IncorporatedChip Express CorporationIntraserver Technology IncDallas SemiconductorHauppauge Computer Works IncZydacron IncRaytheion E-SystemsHayes Microcomputer Products IncCoppercom IncSundance Technology IncST201 Sundance EthernetOce' - Technologies B.V.Ford Microelectronics IncMcdata CorporationTroika Networks, Inc.Zentai Fibre Channel AdapterKansai Electric Co. LtdC-Media Electronics IncCM8338ACM8338BCM8738CM8738Wildfire CommunicationsAd Lib Multimedia IncNTT Advanced Technology Corp.Pentland Systems LtdAydin CorpComputer Peripherals InternationalMicro Science IncAdvantech Co. LtdPCI-1756Silicon Spice IncArtx Inc9432 TXCR-Systems A/SMeilhaus Electronic GmbHAscor IncFundamental Software IncExcalibur Systems IncOce' Printing Systems GmbHLava Computer mfg IncLava Dual SerialLava Quatro ALava Quatro BLava Port PlusLava Quad ALava Quad BLava Single SerialLava Port 650Lava ParallelDual parallel port controller ALava Dual Parallel port ALava Dual Parallel port BBOCA Research IOPPARAloka Co. LtdTimedia Technology Co LtdPCI2S550 (Dual 16550 UART)DSP Research IncRamix IncElmic Systems IncMatsushita Electric Works LtdGoepel Electronic GmbHSalient Systems CorpMidas lab IncIkos Systems IncIC Ensemble IncICE1712 [Envy24]ICE1724 [Envy24HT]AddonicsMicrosoft CorporationOxford Semiconductor LtdVScom 011H-EP1 1 port parallel adaptorOX16PCI954 (Quad 16950 UART) function 0EXSYS EX-41092 Dual 16950 Serial adapterOXCB950 Cardbus 16950 UARTOX16PCI954 (Quad 16950 UART) function 1OX16PCI952 (Dual 16950 UART)Multiwave Innovation pte LtdConvergenet Technologies IncKyushu electronics systems IncExcel Switching CorpApache Micro Peripherals IncZoom Telephonics IncDigitan Systems IncFanuc LtdVisiontech LtdPsion Dacom plcAds Technologies IncYgrec Systems Co LtdCustom Technology Corp.Videoserver ConnectionsASIC Designers IncStorage Technology Corp.Better On-Line SolutionsEdec Co LtdUnex Technology Corp.Kingmax Technology IncRadiolanMinton Optic Industry Co LtdPix stream IncVitec MultimediaRadicom Research IncITT Aerospace/Communications DivisionGilat Satellite NetworksEdimax Computer Co.Eltec Elektronik GmbHReal Time Devices US Inc.CIS Technology IncNissin Inc CoAtmel-dreamOutsource Engineering & Mfg. IncStargate Solutions IncCanon Research Center, AmericaAmlogic IncTamarack Microelectronics IncJones Futurex IncLightwell Co Ltd - Zax DivisionALGOL Corp.AGIE LtdPhoenix Contact GmbH & Co.Unibrain S.A.TRWLogical DO LtdGraphin Co LtdAIM GmBHAlesis Studio ElectronicsTUT Systems IncAdlink TechnologyPCI-7296PCI-7432PCI-7433PCI-7434PCI-7841PCI-8133PCI-8554PCI-9111PCI-9113PCI-9114Loronix Information Systems IncCatalina Research IncSamsung Electronics Co LtdOLITECAskey Computer Corp.Octave Communications Ind.SP3D Chip Design GmBHMYCOM IncAltiga NetworksLogic Plus Plus IncAdvanced Hardware ArchitecturesNuera Communications IncGiga-byte TechnologyDOOIN ElectronicsEscalate Networks IncPRAIM SRLCryptekGallant Computer IncAashima Technology B.V.Baldor Electric CompanyNextMove PCIDYNARC INCAvermedia Technologies IncMicro-Star International Co., Ltd.Fast CorporationInteractive Circuits & Systems LtdGN NETTEST Telecom DIV.Designpro Inc.DIGICOM SPAAMBIT Microsystem Corp.Cleveland Motion ControlsIFRParascan Technologies LtdRuby Tech Corp.FE-1430TX Fast Ethernet PCI AdapterTachyon, INC.Williams Electronics Games, Inc.Multi Dimensional Consulting IncBay NetworksIntegrated Telecom Express IncDAIKIN Industries, LtdZAPEX Technologies IncDoug Carson & AssociatesPICAZO CommunicationsMORTARA Instrument IncNet InsightDIATREND CorporationTORAY Industries IncFORMOSA Industrial ComputingABIT Computer Corp.AWARE, Inc.Interworks Computer ProductsMatsushita Graphic Communication Systems, Inc.NIHON UNISYS, Ltd.SCII TelecomBIOPAC Systems IncISYTEC - Integrierte Systemtechnik GmBHLABWAY CorporationLogic CorporationERMA - Electronic GmBHL3 Communications Telemetry & InstrumentationMARQUETTE Medical SystemsKONTRON Electronik GmBHKYE Systems CorporationOPTOINNOMEDIALOGIC Inc.C.P. Technology Co. LtdDIGICOM Systems, Inc.HCF 56k Data/Fax ModemOSI Plus CorporationPlant Equipment, Inc.Stone Microsystems PTY Ltd.ZEAL CorporationTime Logic CorporationMAKER CommunicationsWINTOP Technology, Inc.TOKAI Communications Industry Co. LtdJOYTECH Computer Co., Ltd.SMA Regelsysteme GmBHTEWS Datentechnik GmBHEMTEC CO., LtdANDOR Technology LtdSEIKO Instruments IncOVISLINK Corp.NEWTEK IncVideo Toaster for PCMapletree Networks Inc.LECTRON Co LtdSOFTING GmBHSystembase Co LtdMillennium Engineering IncMaverick NetworksGVC/BCM Advanced ResearchXIONICS Document Technologies IncINOVA Computers GmBH & Co KGMYTHOS Systems IncFEATRON Technologies CorporationHIVERTEC IncAdvanced MOS Technology IncMentor Graphics Corp.Novaweb Technologies IncTime Space Radio ABCTI, IncGuillemot Corporation3D Prophet II MXBST Communication Technology LtdNextcom K.K.ENNOVATE Networks IncXPEED IncDSL NICPHILIPS Business Electronics B.V.Creamware GmBHScopePulsarPulsar2Pulsar2DSP-BoardDSP-BoardDSP-BoardDSP-BoardQuantum Data Corp.PROXIM IncSymphony 4110Techsoft Technology Co LtdAIRONET Wireless CommunicationsPC4800PC4800PC4800PC4500PC4800Cisco Aironet Wireless 802.11bINTERNIX Inc.SEMTECH CorporationGlobespan Semiconductor Inc.CARDIO Control N.V.L3 CommunicationsSPIDER Communications Inc.COMPAL Electronics IncMYRICOM Inc.DTK ComputerMEDIATEK Corp.IWASAKI Information Systems Co LtdAutomation Products ABData Race IncModular Technology Holdings LtdTurbocomm Tech. Inc.ODIN Telesystems IncPE Logic Corp.Billionton Systems IncNAKAYO Telecommunications IncUniversal Scientific Ind.Whistle CommunicationsTEK Microsystems Inc.Ericsson Axe R & DComputer Hi-Tech Co LtdTitan Electronics IncVScom 010L 1 port parallel adaptorVScom 020L 2 port parallel adaptorVScom 100L 1 port serial adaptorVScom 110L 1 port serial and 1 port parallel adaptorVScom 200L 1 port serial adaptorVScom 210L 2 port serial and 1 port parallel adaptorVScom 400L 4 port serial adaptorVScom 800L 8 port serial adaptorVScom 010H 1 port parallel adaptorVScom 100H 1 port serial adaptorVScom 400H 4 port serial adaptorVScom 400HF1 4 port serial adaptorVScom 200H 2 port serial adaptorVScom 010HV2 1 port parallel adaptorVScom 100HV2 1 port serial adaptorVScom 200HV2 2 port serial adaptorCIRTECH (UK) LtdPanacom Technology CorpNitsuko CorporationAccusys IncHirakawa Hewtech CorpHOPF Elektronik GmBHAlpha Processor IncNational Aerospace LaboratoriesAFAVLAB Technology IncTK9902Amplicon Liveline LtdPCI230PCI242PCI244PCI247PCI248PCI249PCI260PCI224PCI234PCI236PCI272PCI215Boulder Design Labs IncApplied Integration CorporationASIC Communications CorpINVERTEXINFOLIBRIAAMTELCOBroadcom CorporationNetXtreme BCM5700 Gigabit EthernetNetXtreme BCM5701 Gigabit EthernetNetXtreme BCM5702 Gigabit EthernetNetXtreme BCM5703 Gigabit EthernetNetXtreme BCM5704 Gigabit EthernetNetXtreme BCM5704S Gigabit EthernetNetXtreme BCM5702FE Gigabit EthernetNetXtreme BCM5705 Gigabit EthernetNetXtreme BCM5705_2 Gigabit EthernetNetXtreme BCM5720 Gigabit EthernetNetXtreme BCM5721 Gigabit EthernetNetXtreme BCM5705M Gigabit EthernetNetXtreme BCM5705M_2 Gigabit EthernetNetXtreme BCM5705F Gigabit EthernetNetXtreme BCM5750 Gigabit EthernetNetXtreme BCM5751 Gigabit EthernetNetXtreme BCM5750M Gigabit EthernetNetXtreme BCM5751M Gigabit EthernetNetXtreme BCM5751F Gigabit EthernetNetXtreme BCM5782 Gigabit EthernetNetXtreme BCM5788 Gigabit EthernetNetXtreme BCM5789 Gigabit EthernetNetXtreme BCM5702 Gigabit EthernetNetXtreme BCM5703 Gigabit EthernetNetXtreme BCM5704S Gigabit EthernetNetXtreme BCM5702 Gigabit EthernetNetXtreme BCM5703 Gigabit EthernetNetXtreme BCM5901 Gigabit EthernetNetXtreme BCM5901_2 Gigabit EthernetBCM4210 iLine10 HomePNA 2.0BCM4211 iLine10 HomePNA 2.0 + V.90 56k modemBCM4212 v.90 56k modemBCM4301 802.11bBCM94306 802.11gBCM4401 100Base-TBCM4402 Integrated 10/100BaseTBCM4413 iLine32 HomePNA 2.0BCM4413 V.90 56k modemBCM4413 10/100BaseTBCM5820 Crypto AcceleratorBCM5821 Crypto AcceleratorPixelfusion LtdSHINING Technology Inc3CXRAYCER IncGARNETS System CO LtdPlanex Communications, IncFNW-3603-TX CardBus Fast EthernetSEIKO EPSON CorpACQIRISDATAKINETICS LtdMASPRO KENKOH CorpCARRY Computer ENG. CO LtdCANON RESEACH CENTRE FRANCEConexantHCF 56k ModemHCF 56k ModemHCF 56k ModemHCF 56k ModemHCF 56k ModemHCF 56k ModemHCF 56k ModemHCF 56k ModemHCF 56k ModemHCF 56k ModemHCF 56k ModemHCF 56k Data/Fax ModemHCF 56k Data/Fax/Voice ModemHCF 56k Data/Fax/Voice/Spkp (w/Handset) ModemHCF 56k Data/Fax/Voice/Spkp ModemHCF 56k Data/Fax Modem (Worldwide)HCF 56k Data/Fax Modem (Worldwide)HCF 56k Data/Fax/Voice Modem (Worldwide)HCF 56k Data/Fax/Voice/Spkp (w/Handset) Modem (Worldwide)HCF 56k Data/Fax/Voice/Spkp Modem (Worldwide)HCF 56k Data/Fax/Voice/Spkp Modem (Worldwide)HCF 56k Data/Fax/Voice Modem (Worldwide)HCF 56k Data/Fax ModemHCF 56k Data/Fax/Voice ModemHCF 56k Data/Fax/Voice/Spkp (w/Handset) ModemHCF 56k Data/Fax/Voice/Spkp ModemHCF 56k Data/Fax ModemHCF 56k Data/Fax/Voice ModemHCF 56k Data/Fax/Voice/Spkp (w/Handset) ModemHCF 56k Data/Fax ModemHCF 56k Data/Fax ModemHCF 56k Data/Fax/Voice ModemHCF 56k Data/Fax/Voice/Spkp (w/Handset) ModemHCF 56k Data/Fax/Voice/Spkp ModemADSL AccessRunner PCI Arbitration DeviceAccessRunner PCI ADSL Interface DeviceADSL AccessRunner V2 PCI Arbitration DeviceAccessRunner V2 PCI ADSL Interface DeviceAccessRunner V2 PCI ADSL Yukon WAN AdapterHCF 56k ModemHCF 56k ModemHSF 56k Data/Fax ModemHSF 56k Data/Fax/Voice ModemHSF 56k Data/Fax/Voice/Spkp (w/Handset) ModemHSF 56k Data/Fax/Voice/Spkp ModemHSF 56k Data/Fax ModemHSF 56k Data/Fax/Voice ModemHSF 56k Data/Fax/Voice/Spkp (w/Handset) ModemHSF 56k Data/Fax/Voice/Spkp ModemHSF 56k Data/Fax Modem (WorldW SmartDAA)HSF 56k Data/Fax/Voice Modem (WorldW SmartDAA)HSF 56k Data/Fax/Voice/Spkp (w/Handset) Modem (WorldW SmartDAA)HSF 56k Data/Fax/Voice/Spkp Modem (WorldW SmartDAA)HSF 56k Data/Fax Modem (SmartDAA)HSF 56k Data/Fax/Voice Modem (SmartDAA)HSF 56k Data/Fax/Voice/Spkp (w/Handset) Modem (SmartDAA)HSF 56k Data/Fax/Voice/Spkp Modem (SmartDAA)HSF 56k ModemHSF 56k Data/Fax/Cell Modem (Mob WorldW SmartDAA)HSF 56k Data/Fax/Voice/Cell Modem (Mob WorldW SmartDAA)HSF 56k Data/Fax/Voice/Spkp (w/HS)/Cell Modem (Mob WorldW SmartDAA)HSF 56k Data/Fax/Voice/Spkp/Cell Modem (Mob WorldW SmartDAA)HSF 56k Data/Fax/Cell Modem (Mob SmartDAA)HSF 56k Data/Fax/Voice/Cell Modem (Mob SmartDAA)HSF 56k Data/Fax/Voice/Spkp (w/HS)/Cell Modem (Mob SmartDAA)HSF 56k Data/Fax/Voice/Spkp/Cell Modem (Mob SmartDAA)HSF 56k Data/Fax CardBus Modem (Mob WorldW SmartDAA)HSF 56k Data/Fax/Voice CardBus Modem (Mob WorldW SmartDAA)HSF 56k Data/Fax/Voice/Spkp (w/HS) CardBus Modem (Mob WorldW SmartDAA)HSF 56k Data/Fax/Voice/Spkp CardBus Modem (Mob WorldW SmartDAA)HSF 56k Data/Fax CardBus Modem (Mob SmartDAA)HSF 56k Data/Fax/Voice CardBus Modem (Mob SmartDAA)HSF 56k Data/Fax/Voice/Spkp (w/HS) CardBus Modem (Mob SmartDAA)HSF 56k Data/Fax/Voice/Spkp CardBus Modem (Mob SmartDAA)HSF 56k Data/Fax Modem (Mob WorldW SmartDAA)HSF 56k Data/Fax/Voice Modem (Mob WorldW SmartDAA)HSF 56k Data/Fax/Voice/Spkp (w/HS) Modem (Mob WorldW SmartDAA)HSF 56k Data/Fax/Voice/Spkp Modem (Mob WorldW SmartDAA)HSF 56k Data/Fax Modem (Mob SmartDAA)HSF 56k Data/Fax/Voice Modem (Mob SmartDAA)HSF 56k Data/Fax/Voice/Spkp (w/HS) Modem (Mob SmartDAA)HSF 56k Data/Fax/Voice/Spkp Modem (Mob SmartDAA)HSF 56k HSFi ModemRS8234 ATM SAR Controller [ServiceSAR Plus]MOBILITY ElectronicsBROADLOGICTOKYO Electronic Industry CO LtdSOPAC LtdCOYOTE Technologies LLCWOLF Technology IncAUDIOCODES IncAG COMMUNICATIONSWANDEL & GOCHERMANNTRANSAS MARINE (UK) LtdQuadrics LtdQsNet Cluster InterconnectQsNetII Cluster InterconnectJAPAN Computer Industry IncARCHTEK TELECOM CorpTWINHEAD INTERNATIONAL CorpDELTA Electronics, IncBANKSOFT CANADA LtdMITSUBISHI ELECTRIC LOGISTICS SUPPORT Co LtdKAWASAKI LSI USA IncKAISER ElectronicsITA INGENIEURBURO FUR TESTAUFGABEN GmbHCHAMELEON Systems IncMotorola ?? / HTECMPC105 [Eagle]MPC106 [Grackle]MPC8240 [Kahlua]MC145575 [HFC-PCI]KTI829c 100VGRavenFalconHawkCPX8216HONDA CONNECTORS/MHOTRONICS IncFIRST INTERNATIONAL Computer IncFORVUS RESEARCH IncYAMASHITA Systems CorpKYOPAL CO LtdWARPSPPED IncC-PORT CorpINTEC GmbHBEHAVIOR TECH Computer CorpCENTILLIUM Technology CorpROSUN Technologies IncRaychemTFL LAN IncAdvent designMYSON Technology IncSURECOM EP-320X-S 100/10M Ethernet PCI AdapterECHOTEK CorpPEP MODULAR Computers GmbHTELEFON AKTIEBOLAGET LM EricssonGlobetekPCI-1002PCI-1004PCI-1008COMBOX LtdDIGITAL AUDIO LABS IncFujitsu Computer Products Of AmericaMATRIX CorpTOPIC SEMICONDUCTOR CorpTP560 Data/Fax/Voice 56k modemCHAPLET System IncBELL CorpMainPine LtdPCI <-> IOBus BridgeMUSIC SemiconductorsENE Technology IncCB1211 Cardbus ControllerCB1225 Cardbus ControllerCB1410 Cardbus ControllerCB1420 Cardbus ControllerIMPACT TechnologiesISS, IncSOLECTRONACKSYSAMERICAN MICROSystems IncQUICKTURN DESIGN SystemsFLYTECH Technology CO LtdMACRAIGOR Systems LLCQUANTA Computer IncMELEC IncPHILIPS - CRYPTOACQIS Technology IncCHRYON CorpECHELON CorpBALTIMOREROAD CorpEVERGREEN Technologies IncDATALEX COMMUNCATIONSARALION IncATELIER INFORMATIQUES et ELECTRONIQUE ETUDES S.A.ONO SOKKITERRATEC Electronic GmbHANTAL ElectronicFILANET CorpTECHWELL IncMIPS DENMARKPROVIDEO MULTIMEDIA Co LtdMACHONE CommunicationsVIVID Technology IncSILICON LaboratoriesIntel 537 [Winmodem]Si3036 MC'97 DAADCM DATA SystemsVISIONTEKIOI Technology CorpMITUTOYO CorpJET PROPULSION LaboratoryINTERCONNECT Systems SolutionsMAX Technologies IncCOMPUTEX Co LtdVISUAL Technology IncPAN INTERNATIONAL Industrial CorpSERVOTEST LtdSTRATABEAM TechnologyOPEN NETWORK Co LtdSMART Electronic DEVELOPMENT GmBHRACAL AIRTECH LtdCHICONY Electronics Co LtdPROLINK Microsystems CorpGESYTEC GmBHPLD APPLICATIONSMEDIASTAR Co LtdCLEVO/KAPOK ComputerSI LOGIC LtdINNOMEDIA IncPROTAC INTERNATIONAL CorpCemax-Icon IncMac System Co LtdLP Elektronik GmbHPerle Systems LtdTerayon Communications SystemsViewgraphics IncSymbol TechnologiesA-Trend Technology Co LtdYamakatsu Electronics Industry Co LtdBiostar Microtech Int'l CorpArdent Technologies IncJungsoftDDK Electronics IncPalit Microsystems Inc.Avtec Systems2wire IncVidac Electronics GmbHAlpha-Top CorpAlfa IncM-Systems Flash Disk Pioneers LtdLecroy CorpContemporary ControlsCCSI PCI20-485 ARCnetCCSI PCI20-485D ARCnetCCSI PCI20-485X ARCnetCCSI PCI20-CXB ARCnetCCSI PCI20-CXS ARCnetCCSI PCI20-FOG-SMA ARCnetCCSI PCI20-FOG-ST ARCnetCCSI PCI20-TB5 ARCnetCCSI PCI20-5-485 5Mbit ARCnetCCSI PCI20-5-485D 5Mbit ARCnetCCSI PCI20-5-485X 5Mbit ARCnetCCSI PCI20-5-FOG-ST 5Mbit ARCnetCCSI PCI20-5-FOG-SMA 5Mbit ARCnetCCSI PCI22-485 10Mbit ARCnetCCSI PCI22-485D 10Mbit ARCnetCCSI PCI22-485X 10Mbit ARCnetCCSI PCI22-CHB 10Mbit ARCnetCCSI PCI22-FOG_ST 10Mbit ARCnetCCSI PCI22-THB 10Mbit ARCnetOtis Elevator CompanyLattice - VantisFairchild SemiconductorVoltaire Advanced Data Security LtdViewcast COMHITTDual Technology CorpJapan Elecronics Ind IncStar Multimedia CorpEurosoft (UK)Fix2000 PCI Y2K Compliance CardGemflex NetworksTransition NetworksPX Instruments Technology LtdPrimex Aerospace CoSEH Computertechnik GmbHCytec CorpInet Technologies IncUniwill Computer CorpLogitronLancast IncKonica CorpSolidum Systems CorpAtlantek Microsystems Pty LtdDigalog Systems IncAllied Data TechnologiesHitachi Semiconductor & Devices Sales Co LtdPoint Multimedia SystemsLara Technology IncDitect Coop3pardata IncARNSyba Tech LtdMulti-IO CardParallel Port Card 2xEPPMulti-IO CardMulti-IO CardMulti-IO CardMulti-IO CardMulti-IO CardMulti-IO CardBops IncNetgame LtdDiva Systems CorpFolsom Research IncMemec Design ServicesGranite MicrosystemsDelta Electronics IncGeneral InstrumentFaraday Technology CorpStratus Computer SystemsNingbo Harrison Electronics Co LtdA-Max Technology Co LtdGalea Network SecurityCompumaster SRLGeocast Network SystemsCatalyst Enterprises IncTA700 PCI Bus Analyzer/ExerciserItaltelX-Net OYToyota Macs IncSunlight Ultrasound Technologies LtdSSE Telecom IncShanghai Communications Technologies CenterMoreton BayBluesteel Networks IncNorth Atlantic InstrumentsVMWare IncVirtual SVGAAmersham Pharmacia BiotechZoltrix International LtdSource Technology IncMosaid Technologies IncMellanox TechnologyMT21108 InfiniBridgeCCI/TRIADCimetrics IncTexas Memory Systems IncSandisk CorpADDI-DATA GmbHMaestro Digital CommunicationsImpacct Technology CorpPortwell IncAgilent TechnologiesE2929A PCI/PCI-X Bus AnalyzerDFI IncSola ElectronicsHigh Tech Computer Corp (HTC)BVM LtdQuantelNewer Technology IncTaiwan Mycomp Co LtdEVSX IncProcomp Informatics LtdTechnical University of BudapestTateyama System Laboratory Co LtdTateyama C-PCI PLC/NC card Rev.01APenta Media Co LtdSerome Technology IncBitboys OYAG Electronics LtdHotrail IncDreamtech Co LtdGenrad IncHilscher GmbHInfineon Technologies AGFIC (First International Computer Inc)NDS Technologies Israel LtdIwill CorpTatung CoEntridia CorpRockwell-Collins IncCybernetics Technology Co LtdSuper Micro Computer IncCyberfirm IncApplied Computing Systems IncLitronic IncArgus 300 PCI Cryptography ModuleSigmatel IncMalleable Technologies IncInfinilink CorpCacheflow IncVoice Technologies Group IncQuicknet Technologies IncNetworth Technologies IncVSN Systemen BVValley technologies IncAgere IncGet Engineering CorpNational Datacomm CorpWireless PCI CardPacific Digital CorpADMA-100 DiscStaQ ATA ControllerTokyo Denshi Sekei K.K.Drsearch GmbHBeckhoff GmbHMacrolink IncIn Win Development IncIntelligent Paradigm IncB-Tree Systems IncTimes N Systems IncDiagnostic Instruments IncDigitmedia CorpValuesoftPower Micro ResearchExtreme Packet Device IncBanctecKoga Electronics CoZenith Electronics CorpJ.P. Axzam CorpZilog IncTechsan Electronics Co LtdN-CUBED.NETKinpo Electronics IncFastpoint Technologies IncNorthrop Grumman - Canada LtdTenta TechnologyProsys-tec IncNokia Wireless CommunicationsCentral System Research Co LtdPairgain TechnologiesEuropop AGLava Semiconductor Manufacturing IncAutomated Wagering InternationalScimetric Instruments IncTelesynergy Research Inc.FarSite Communications LtdFarSync T2P (2 port X.21/V.35/V.24)FarSync T4P (4 port X.21/V.35/V.24)Kongsberg Spacetec ASFormat synchronizer v3.0Fast Universal Data OutputStandard Microsystems Corp [SMC]SMC2602W EZConnect / Addtron AWA-100Smart Link Ltd.SmartLink SmartPCI562 56K ModemSmartPCI561 ModemBrocade Communications Systems, Inc.Epix IncPIXCI(R) CL1 Camera Link Video Capture Board [custom QL5232]PIXCI(R) D2X Digital Video Capture Board [custom QL5232]PIXCI(R) D3X Digital Video Capture Board [custom QL5232]Hsing Tech. Enterprise Co., Ltd.Worldspace Corp.Actiontec Electronics IncHerculesGlobal Sun Technology IncPCMCIA-to-PCI Wireless Network BridgeCreatix Polymedia GmbHCENATEK IncRocket Drive DLU.S. RoboticsWireless Access PCI Adapter Model 022415VideoTele.com, Inc.Digital First, Inc.NetOctave IncYottaYotta Inc.Accelerated EncryptionLinksysGigabit Network AdapterGigabit Network AdapterAltima (nee Broadcom)AC1000 Gigabit EthernetAC1001 Gigabit EthernetAC9100 Gigabit EthernetAC1003 Gigabit EthernetPeppercon AGROL/F-100 Fast Ethernet Adapter with ROLPC Partner LimitedSanera Systems, Inc.Hightech Information System Ltd.Research Centre JuelichSIS1100 [Gigabit link]HOTlinkCounter TimerCAMAC ControllerPROFIBUSAMCC HOTlinkBelkinHightech Information System Ltd.NetChip Technology, IncUSB 2.0Ambient Technologies IncHaM controllerless modemHaM plus Data Fax ModemMicrotune, Inc.Anritsu Corp.Varisys LtdVMFX1 FPGA PMC moduleVSM2 dual PMC carrierVS14x series PowerPC PCI boardVS24x series PowerPC PCI boardSierra semiconductorSC15064Jaton CorpSymphony82C101DPTPM2x24/PM3224Tekram Technology Co.,Ltd.TRM-S1040DC-390690cDC290Tumsan OyE2200 Dual E1/Rawpipe CardSmart Link Ltd.Temporal Research LtdSmart Link Ltd.Smart Link Ltd.21st Century Computer Corp.Racore8142 100VG/AnyLANKingston TechnologiesXantel CorporationChaintech Computer Co. LtdAVID Technology Inc.3D Vision(???)Hansol Electronics Inc.Post Impression Systems.Hint CorpHiNT HC4 PCI to ISDN bridge, Multimedia audio controllerHiNT HC4 PCI to ISDN bridge, Network controllerHB1-SE33 PCI-PCI BridgeE.Band [AudioTrak Inca88]E.Band [AudioTrak Inca88]VXPro II ChipsetVXPro II ChipsetVXPro II IDEQuantum Designs (H.K.) IncARCOM Control Systems Ltd4Links3DLabsGLINT 300SXGLINT 500TXGLINT DeltaPermediaPermediaGLINT MX3D ExtremeGLINT Gamma G1Permedia II 2D+3DGLINT R3GLINT R3 [Oxygen VX1]Permedia II 2D+3DPermediaPermediaGlint VGAAvance Logic Inc.ALS300 PCI Audio DeviceALS300+ PCI Audio DevicePCI Input ControllerALG-2064ALG-2064iALG-2364A GUI AcceleratorALG-2301ALG-2302AVG-2302 GUI AcceleratorALG-2364AALG-2464ALG-2564A/25128AALS4000 Audio ChipsetALC200/200PAddtron Technology Co, Inc.RTL8139 EthernetDigital Equipment CorpAladdin Knowledge SystemsAladdinCARDCPCInternext Compression InciTVC15 MPEG-2 EncoderBridgeport machinesCogetec Informatique IncBaldor Electric CompanyUmax Computer CorpHercules Computer Technology IncRedCreek Communications IncRedCreek PCI adapterGrowth NetworksAxil Computer IncNetVinNV5000SCBuslogic Inc.LUNG HWA ElectronicsSBS TechnologiesSeanix Technology IncMediaQ Inc.MQ-200Microtechnica Co LtdILC Data Device CorpDD-42924I5-300 (ARINC 429 Data Bus)BU-65570I1 MIL-STD-1553 Test and SimulationBU-65570I2 MIL-STD-1553 Test and SimulationBU-65572I1 MIL-STD-1553 Test and SimulationBU-65572I2 MIL-STD-1553 Test and SimulationBU-65570T1 MIL-STD-1553 Test and SimulationBU-65570T2 MIL-STD-1553 Test and SimulationBU-65572T1 MIL-STD-1553 Test and SimulationBU-65572T2 MIL-STD-1553 Test and SimulationBU-65565C1 MIL-STD-1553 Data BusBU-65565C2 MIL-STD-1553 Data BusBU-65565C3 MIL-STD-1553 Data BusBU-65565C4 MIL-STD-1553 Data BusBU-65569I1 MIL-STD-1553 Data BusBU-65569I2 MIL-STD-1553 Data BusBU-65569I3 MIL-STD-1553 Data BusBU-65569I4 MIL-STD-1553 Data BusGemTek Technology CorporationPCI RadioVoyetra TechnologiesDaytona Audio AdapterS S TechnologiesQualcomm IncEnsoniq (Old)Concert AudioPCIAnimation Technologies Inc.Alliance Semiconductor Corp.ProMotion aT3DS3 Inc.Plato/PX (system)86c325 [ViRGE]86c866 [Vision 866]86c964 [Vision 964]86c764_0 [Trio 32 vers 0]86c764/765 [Trio32/64/64V+]86cM65 [Aurora64V+]86c764_3 [Trio 32/64 vers 3]86c767 [Trio 64UV+]86cM65 [Aurora 128]86c988 [ViRGE/VX]FireGL86c868 [Vision 868 VRAM] vers 086c868 [Vision 868 VRAM] vers 186c868 [Vision 868 VRAM] vers 286c868 [Vision 868 VRAM] vers 386c928 [Vision 928 VRAM] vers 086c928 [Vision 928 VRAM] vers 186c928 [Vision 928 VRAM] vers 286c928 [Vision 928 VRAM] vers 386c864 [Vision 864 DRAM] vers 086c864 [Vision 864 DRAM] vers 186c864 [Vision 864-P DRAM] vers 286c864 [Vision 864-P DRAM] vers 386c964 [Vision 964 VRAM] vers 086c964 [Vision 964 VRAM] vers 186c964 [Vision 964-P VRAM] vers 286c964 [Vision 964-P VRAM] vers 386c968 [Vision 968 VRAM] rev 086c968 [Vision 968 VRAM] rev 186c968 [Vision 968 VRAM] rev 286c968 [Vision 968 VRAM] rev 386c755 [Trio 64V2/DX]86c775/86c785 [Trio 64V2/DX or /GX]Plato/PXTrio 3D business multimediaTrio 64 3DTrio 64V+ familyTrio 64V+ familyTrio 64V+ familyTrio 64V+ familyTrio 64V+ familyTrio 64V+ familyTrio 64V+ familyTrio 64V+ familyTrio 64V+ familyTrio 64V+ familyTrio 64V+ familyViRGE/DX or /GXViRGE/GX286c368 [Trio 3D/2X]86c794 [Savage 3D]86c390 [Savage 3D/MV]Savage 4Savage 4ProSavage PM133ProSavage KM133ViRGE/M3ViRGE/MXViRGE/MX+ViRGE/MX+MV86C270-294 Savage/MX-MV82C270-294 Savage/MX86C270-294 Savage/IX-MV86C270-294 Savage/IXSuperSavage MX/128SuperSavage MX/64SuperSavage MX/64CSuperSavage IX/128 SDRSuperSavage IX/128 DDRSuperSavage IX/64 SDRSuperSavage IX/64 DDRSuperSavage IX/C SDRSuperSavage IX/C DDR86C380 [ProSavageDDR K4M266]VT8636A [ProSavage KN133] AGP4X VGA Controller (TwisterK)VT8751 [ProSavageDDR P4M266]VT8375 [ProSavage8 KM266/KL266]86C410 Savage 2000SonicVibesTeralogic IncTL880-based HDTV/ATSC tunerTechnische University BerlinS5933Cnet Technologies, Inc.Dunord TechnologiesI-30xx Scanner InterfaceGenroco, IncTURBOstor HFP-832 [HiPPI NIC]VoiceTronix Pty LtdNetpowerUltraStorc't Magazin fr ComputertechnikGPPCILogitec Corp.Decision Computer International Co.PCCOM4PCCOM8O.N. Electronic Co Ltd.MIDAC CorporationPowerTVQuancom Electronic GmbHWDOG1 [PCI-Watchdog 1]PWDOG2 [PCI-Watchdog 2]Intel Corp.82379ABExtended Express System Support Controller2114582437FX82375EB82424ZX [Saturn]82378IB [SIO ISA Bridge]82430ZX [Aries]82434LX [Mercury/Neptune]82437FX [Triton FX]RAID Controller80960RP [i960 RP Microprocessor/Bridge]80960RM [i960RM Bridge]80960RP [i960 RP Microprocessor/Bridge]82542 Gigabit Ethernet Controller82543GC Gigabit Ethernet Controller (Fiber)Pro 100 LAN+Modem 56 Cardbus II82543GC Gigabit Ethernet Controller (Copper)82544EI Gigabit Ethernet Controller (Copper)82544EI Gigabit Ethernet Controller (Fiber)82544GC Gigabit Ethernet Controller (Copper)82544GC Gigabit Ethernet Controller (LOM)82540EM Gigabit Ethernet Controller82545EM Gigabit Ethernet Controller (Copper)82546EB Gigabit Ethernet Controller (Copper)82545EM Gigabit Ethernet Controller (Fiber)82546EB Gigabit Ethernet Controller (Fiber)82540EM Gigabit Ethernet Controller (LOM)82559 Ethernet Controller82559 InBusiness 10/10082801CAM (ICH3) PRO/100 VE (LOM) Ethernet Controller82801CAM (ICH3) PRO/100 VE Ethernet Controller82801CAM (ICH3) PRO/100 VM (LOM) Ethernet Controller82801CAM (ICH3) PRO/100 VM Ethernet Controller82801CAM (ICH3)/82562EH (LOM) Ethernet Controller82801CAM (ICH3) 82562EH Ethernet Controller82801CAM (ICH3) Chipset Ethernet Controller82801CAM (ICH3) PRO/100 VM (KM) Ethernet Controller82801BD PRO/100 VE (LOM) Ethernet Controller82801BD PRO/100 VE (CNR) Ethernet Controller82801BD PRO/100 VM (LOM) Ethernet Controller82801BD PRO/100 VM (CNR) Ethernet Controller82801BD PRO/100 VE (MOB) Ethernet Controller82801BD PRO/100 VM (MOB) Ethernet Controller536EP Data Fax ModemPRO/Wireless LAN 2100 3B Mini PCI Adapter82551QM Ethernet Controller82815 815 Chipset Host Bridge and Memory Controller Hub82815 815 Chipset AGP Bridge82815 CGC [Chipset Graphics Controller]82806AA PCI64 Hub Advanced Programmable Interrupt ControllerXscale 80200 Big Endian Companion ChipIntel IXP1200 Network Processor82559ER82092AA_082092AA_1SAA711682452KX/GX [Orion]82596 PRO/10 PCI82865 EtherExpress PRO/100A82556 EtherExpress PRO/100 Smart82557/8/9 [Ethernet Pro 100]430FX - 82437FX TSC [Triton I]82371FB PIIX ISA [Triton I]82371FB PIIX IDE [Triton I]DSVD Modem430MX - 82371MX Mobile PCI I/O IDE Xcelerator (MPIIX)430MX - 82437MX Mob. System Ctrlr (MTSC) & 82438MX Data Path (MTDP)440FX - 82441FX PMC [Natoma]82371FB82380PB82380AB683053 Programmable Interrupt Device82466GX Integrated Hot-Plug Controller (IHPC)752 AGP82380FB430HX - 82439HX TXC [Triton II]82806AA PCI64 Hub PCI Bridge82806AA PCI64 Hub Controller (HRes)82870P2 P64H2 Hub PCI Bridge82870P2 P64H2 I/OxAPIC82870P2 P64H2 Hot Plug Controller80960RP [i960RP Microprocessor]80960RM [i960RM Microprocessor]82840 840 (Carmel) Chipset Host Bridge (Hub A)82840 840 (Carmel) Chipset AGP Bridge82840 840 (Carmel) Chipset PCI Bridge (Hub B)82845 845 (Brookdale) Chipset Host Bridge82845 845 (Brookdale) Chipset AGP Bridge82801AA ISA Bridge (LPC)82801AA IDE82801AA USB82801AA SMBus82801AA AC'97 Audio82801AA AC'97 Modem82801AA PCI Bridge82801AB ISA Bridge (LPC)82801AB IDE82801AB USB82801AB SMBus82801AB AC'97 Audio82801AB AC'97 Modem82801AB PCI Bridge82801BA ISA Bridge (LPC)82801BA/BAM USB (Hub #1)82801BA/BAM SMBus82801BA/BAM USB (Hub #2)82801BA/BAM AC'97 AudioIntel 537 [82801BA/BAM AC'97 Modem]82801BAM/CAM PCI Bridge82801BA/BAM/CA/CAM Ethernet Controller82801BAM IDE U10082801BA IDE U10082801BAM ISA Bridge (LPC)82801BA/CA/DB/EB PCI Bridge82801E ISA Bridge (LPC)82801E USB82801E SMBus82801E Ethernet Controller 082801E IDE U10082801E Ethernet Controller 182801E PCI Bridge82801CA LPC Interface Controller82801CA/CAM USB (Hub #1)82801CA/CAM SMBus Controller82801CA/CAM USB (Hub #2)82801CA/CAM AC'97 Audio Controller82801CA/CAM AC'97 Modem Controller82801CA/CAM USB (Hub #3)82801CAM IDE U10082801CA Ultra ATA Storage Controller82801CAM ISA Bridge (LPC)82801DB LPC Interface Controller82801DB USB (Hub #1)82801DB/DBM SMBus Controller82801DB USB (Hub #2)82801DB AC'97 Audio Controller82801DB AC'97 Modem Controller82801DB USB (Hub #3)82801DBM Ultra ATA Storage Controller82801DB Ultra ATA Storage Controller82801DBM LPC Interface Controller82801DB USB282801EB LPC Interface Controller82801EB Ultra ATA Storage Controller82801EB USB82801EB SMBus Controller82801EB USB82801EB AC'97 Audio Controller82801EB AC'97 Modem Controller82801EB USB82801EB Ultra ATA Storage Controller82801EB LPC Interface Controller82801EB USB282801EB USB82820 820 (Camino) Chipset Host Bridge (MCH)82820 820 (Camino) Chipset Host Bridge (MCH)82820 820 (Camino) Chipset Host Bridge82820 820 (Camino) Chipset AGP Bridge82805AA MTH Memory Translator Hub82804AA MRH-S Memory Repeater Hub for SDRAM82850 850 (Tehama) Chipset Host Bridge (MCH)82860 860 (Wombat) Chipset Host Bridge (MCH)82850 850 (Tehama) Chipset AGP Bridge82860 860 (Wombat) Chipset AGP Bridge82860 860 (Wombat) Chipset PCI BridgeE7500 Memory Controller HubE7000 Series Host RASUM ControllerE7000 Series Hub Interface B PCI-to-PCI BridgeE7000 Series Hub Interface B RASUM ControllerE7000 Series Hub Interface C PCI-to-PCI BridgeE7000 Series Hub Interface C RASUM ControllerE7000 Series Hub Interface D PCI-to-PCI BridgeE7000 Series Hub Interface D RASUM ControllerE7501 Memory Controller HubE7505 Memory Controller HubE7000 Series RAS ControllerE7000 Series Processor to AGP ControllerE7000 Series Hub Interface B PCI-to-PCI BridgeE7000 Series Hub Interface B PCI-to-PCI Bridge RAS ControllerE7205 Memory Controller Hub82845G/GL [Brookdale-G] Chipset Host Bridge82845G/GL [Brookdale-G] Chipset AGP Bridge82845G/GL [Brookdale-G] Chipset Integrated Graphics Device82865G/PE/P Processor to I/O Controller82865G/PE/P Processor to AGP Controller82865G Integrated Graphics Device82865G/PE/P Processor to PCI to CSA Bridge82864G/PE/P Processor to I/O Memory Interface82875P Memory Controller Hub82875P Processor to AGP Controller82875P Processor to PCI to CSA Bridge82875P Processor to I/O Memory InterfaceIntegrated RAID82855PM Processor to I/O Controller82855PM Processor to AGP Controller82830 830 Chipset Host Bridge82830 830 Chipset AGP Bridge82830 CGC [Chipset Graphics Controller]82830 830 Chipset Host Bridge82852/855GM Host Bridge82852/855GM Integrated Graphics DeviceEtherExpress PRO/100 Intelligent ServerEtherExpress PRO/100 Intelligent Server80310 IOP [IO Processor]82371SB PIIX3 ISA [Natoma/Triton II]82371SB PIIX3 IDE [Natoma/Triton II]82371SB PIIX3 USB [Natoma/Triton II]430VX - 82437VX TVX [Triton VX]430TX - 82439TX MTXC82371AB/EB/MB PIIX4 ISA82371AB/EB/MB PIIX4 IDE82371AB/EB/MB PIIX4 USB82371AB/EB/MB PIIX4 ACPI82810 GMCH [Graphics Memory Controller Hub]82810 CGC [Chipset Graphics Controller]82810 DC-100 GMCH [Graphics Memory Controller Hub]82810 DC-100 CGC [Chipset Graphics Controller]82810E DC-133 GMCH [Graphics Memory Controller Hub]82810E DC-133 CGC [Chipset Graphics Controller]82810 DC-133 System and Graphics Controller82810-M DC-100 System and Graphics Controller82810-M DC-133 System and Graphics Controller440LX/EX - 82443LX/EX Host bridge440LX/EX - 82443LX/EX AGP bridge440BX/ZX/DX - 82443BX/ZX/DX Host bridge440BX/ZX/DX - 82443BX/ZX/DX AGP bridge440BX/ZX/DX - 82443BX/ZX/DX Host bridge (AGP disabled)82440MX Host Bridge82440MX AC'97 Audio Controller82440MX AC'97 Modem Controller82440MX ISA Bridge82440MX EIDE Controller82440MX USB Universal Host Controller82440MX Power Management Controller440GX - 82443GX Host bridge440GX - 82443GX AGP bridge440GX - 82443GX Host bridge (AGP disabled)82372FB PIIX5 ISA82372FB PIIX5 IDE82372FB PIIX5 USB82372FB PIIX5 SMBusi740450KX/GX [Orion] - 82454KX/GX PCI bridge450KX/GX [Orion] - 82453KX/GX Memory controller450NX - 82451NX Memory & I/O Controller450NX - 82454NX/84460GX PCI Expander Bridge460GX - 84460GX System Address Controller (SAC)460GX - 84460GX System Data Controller (SDC)460GX - 84460GX AGP Bridge (GXB function 2)460GX - 84460GX Memory Address Controller (MAC)460GX - 84460GX Memory Data Controller (MDC)460GX - 82466GX Wide and fast PCI eXpander Bridge (WXB)460GX - 84460GX AGP Bridge (GXB function 1)Integrated RAIDIntegrated RAIDIntegrated RAIDIntegrated RAID21152 PCI-to-PCI Bridge21154 PCI-to-PCI Bridge21555 Non transparent PCI-to-PCI Bridge450NX/GX [Orion] - 82453KX/GX Memory controller [BUG]Trigem Computer Inc.Video assistent componentT-Square Design Inc.Silicon MagicComputone CorporationKTIET32P2AdaptecAIC-7810AIC-1160 [Family Fibre Channel Adapter]AIC-7821AHA-2930CUAHA-4844W/4844UWAIC-755xAHA-7850AIC-755xAIC-7851AIC-755xAIC-7852AIC-755xAIC-7850AIC-755xAIC-7850AVA-2930AIC-7855ANA-7711 TCP Offload EngineAIC-755xAIC-7856AIC-755xAIC-7850AIC-5800ANA-5910/5930/5940 ATM155 & 25 LAN AdapterANA-5910A/5930A/5940A ATM AdapterAIC-3860AIC-1480 / APA-1480AIC-7860AIC-7861AIC-7860AIC-7860AIC-786xAIC-786xAIC-786xAIC-786xANA620xx/ANA69011AAHA-294x / AIC-7870AHA-2940/2940W / AIC-7871AHA-3940/3940W / AIC-7872AHA-3985 / AIC-7873AHA-2944/2944W / AIC-7874AHA-3944/3944W / AIC-7875AHA-4944W/UW / AIC-7876ANA-7711F Network Accelerator Card (NAC) - OpticalANA-7711C Network Accelerator Card (NAC) - CopperAIC-787xAIC-7810AIC-7815 RAID+Memory Controller ICAIC-7850AHA-2930AIC-7860AIC-7870AHA-2940AHA-3940AHA-3980AHA-2944AIC-7880PAIC-7890AIC-789xAIC-789xAIC-789xAIC-789xAHA-2940U/UW / AHA-39xx / AIC-7895AIC-789xAIC-789xAIC-7880UAHA-2940U/UW/D / AIC-7881UAHA-3940U/UW/UWD / AIC-7882UAHA-3940U/UW / AIC-7883UAHA-2944UW / AIC-7884UAHA-3944U/UWD / AIC-7885AHA-4944UW / AIC-7886AHA-2940UW Pro / AIC-788xAHA-2930UW / AIC-7888ABA-1030AHA-4944W/UWAdaptecAHA-2940U2/U2WAHA-2930U278902AHA-2940U2/U2W / 7890/7891AIC-7890AIC-7890AIC-7890AIC-7890AHA-3940U2x/395U2xAHA-3950U2DAIC-7896 SCSI ControllerAIC-7896U2/7897U2AIC-7892A U160/mAIC-7892B U160/mAIC-7892D U160/mAIC-7892P U160/mAHA-3960D / AIC-7899A U160/mAIC-7899B U160/mAIC-7899D U160/mRAID subsystem HBAAIC-7899P U160/mServeRAID ControllerAAC-RAIDASC-29320A U320AIC-7901 U320ASC-39320 U320ASC-32320D U320ASC-29320 U320ASC-29320B U320ASC-29320LP U320AIC-7901A U320AIC-7902 U320ASC-29320A U320 w/HostRAIDAIC-7901 U320 w/HostRAIDASC-39320 U320 w/HostRAIDASC-39320D U320 w/HostRAIDASC-29320 U320 w/HostRAIDASC-29320B U320 w/HostRAIDASC-29320LP U320 w/HostRAIDASC-39320(B) U320 w/HostRAIDASC-39320A U320 w/HostRAIDASC-29320ALP U320 w/HostRAIDASC-39320D(B) U320 w/HostRAIDAIC-7902(B) U320 w/HostRAIDAIC-7901A U320 w/HostRAIDAIC-7902 U320 w/HostRAIDAtronicsIDE-2015PLGigapixel CorpHoltek6565Omni Media Technology Inc6565NetMos TechnologyVScom 021H-EP2 2 port parallel adaptor222N-2 I/O Card (2S+1P)AOPEN Inc.UNISYS CorporationNEC CorporationHewlett PackardHewlett Packard GmbH PL24-MKTSony3Com CorporationScitex Digital VideoDigital Receiver Technology IncShiva Europe LimitedPinnacle Systems, Inc. (Wrong ID)TSI TelsysMicron/Crucial TechnologyMotorolaMotion Engineering, Inc.Varian Australia Pty LtdChrysalis-ITSCatapult CommunicationsTyzx, Inc.DeepSea 1 High Speed Stereo Vision Frame GrabberDeepSea 2 High Speed Stereo Vision Frame GrabberDy4 Systems IncPCI Mezzanine CardI+ME ACTIA GmbHExsysIndigita CorporationWinbondW89C940Tiger Jet Network Inc.Intel 537Tiger100APC ISDN chipsetEKF Elektronik GmbHEagle TechnologyRMEDigi32Digi32 ProDigi32/8Aashima Technology B.V.Endace Measurement Systems, LtdDAG 3.10 OC-3/OC-12DAG 3.2x OC-3/OC-12DAG 3.2E Fast EthernetDAG 3.4E Fast EthernetDAG 3.41E Fast EthernetDAG 3.5 OC-3/OC-12DAG 3.5ECM Fast EthernetDAG 4.10 OC-48DAG 4.11 OC-48DAG 4.2 OC-48DAG 4.2E Dual Gigabit EthernetBelkin CorporationF5D6000Echo Digital Audio CorporationGina24_301Gina24_361Layla24Mona_301_80Mona_301_66Mona_361MiaARK Logic Inc1000PV [Stingray]2000PV [Stingray]2000MT2000MIAJA VideoKONA SD SMPTE 259M I/OKONA SD SMPTE 259M I/OKONA HD SMPTE 292M I/OFast Search & Transfer ASAUltraview Corp.Broadcom Inc (nee Epigram)BCM4210 iLine10 HomePNA 2.0BCM4230 iLine10 HomePNA 2.0VMWare IncVirtual SVGAIllegal Vendor ID 4IHJh 203040 @`, pDTt) *(+,142T3h45@Cilm @Tp/0J`ưǰװ0ݰLްh߰#4<Dc8dTxx0P (0< D L T \dlt| !0@!"#$%$&0'8(D)LX `$Pp06AdDAxEAFAGAXABB6CH7C\TClXCTETFBGDGGGIGLGMGNGOG$PG,QG@RGTSG\TGdUGVGWGXGYGZGdI eI,fILgIlnIBLDLELFLGLIL(ML8NLTPLlQL|RLSLTLWLXLYL ZL8dLPeL|fLgLFMLMDN0ENTFNxGNHNdNeNfN(gNPhNtAPBPCPDPEPFPGP,HP<IPTJPlKPLPMPNPOPPPQP RP<SPXTPhUPVPWPXPDQEQFQGQ(HQ8IQXJQhKQxLQMQNQOQWQXQ(YQHZQlhQiQjQkQlQERFRGRKRLR ES4FSDGS\HStKSLSMSNSTSFTLTRTST TT8UTPTVhUV|VVpp,HT`l    4dp|d (!##d#d$%t| " 4DP\l|22222G ,8D   08Xh!"#$%&4E(F8eH8@L(<DLT\p 4HD``h```8LX `l "-.6:>E F,GHH\IpNOPSW\|}0DPl H |  B D V ( @ X p CS $ \ d l t 1| 1 2 B   J `  0 1 2, 3D @T `d c    ,  <  T  h @ x 0 p p  p  p p,pPtptttt t t ttt0tHtd@t|AtCtEtFtHtItPtQtTt,UtH`t\atlbt|dthtitjtktmtnt$ , 8D Td t   P` @LXd t0@`p %@` PS,T8YDP\Phx05EIQa$!,#P1h35ABCa4!T1xAGA1C1E1G1I1 Q13 3<!3lRRRR%R)R5R7R@RARBRCR4DRTGRlQR'TQTSTqP|(Tx    84P p!|%'  '%6Ese,hp0 P 8 @PVV1VW`  0D`| !)*, -05D;H>\FxZcgt$ |  ! !! $!,!H!\!d!p!!!%!0"4"@"0H"@T"`"h" p"0|"3"5"E"F"H"P"Q#0#3 #5,#@8#ED#FP#U\# p#a #b #6#Q#S#S#T$U $U,$U8$qU@$UH$U`$Uh$Ux$U$V$b$b$6b$c$c%%c%&cD%pX%pl%p%p%p%p%p%@&T&d& t&(&)&*&0&1'@4'AT'Bt'H'T'd''( (8(L(p((()(*(.(|)0))L)%)d))*0*0 * 0,*uP*!@h*W@****+ +D+h+xp+Vx+W+X+g+h+i+!,$,8,P,"h,$p,%x,2,a,,5,h,!," $-L-0\-- --- -F$.t'0. 5X.@|.@.0.../L,/=P/=d/|/ /// 0!(0"`0#0$0&0'$1)D1d11111111112222 2(20282D2L2 X2!`2"h2#2(202@2A3B(3DL3Pp3Q3R3S3U3V4`,4T4p4 494V44 5,5 @5P5h5t5555@5@ 5ZZ5f5p50X6`t6b6c666677(71<7L7h7H|7H7H7H7hM7V7d70 L88 T8u\8v3d80Mp83Mx88M8hM8iM8uR8S8hb8ib8!f8ur8 #P99#\9=Il9HS999: :::$::g,:;g8:H:jP:X:`:h:p:x::&:::::::4;@;d;;;;<D<<<<P<U<V=X=t========>>(> 8>!H>"`>$t>%>&>'>(>)>-?.?/0?0L?1h?2|?3?4?E?@$@@@d@t@AA@AHAPA\AhA tA A AAA B BxNLBB B"BC C@LChC pC!C"C#C#CD(D4DDD\DpDDDDDDDdEEEEEE(F8FHF TFdFtFF#F'F1F3FFGGGG 8GG4HLH@dH0tHHHHI`?tfghi܏jk l m4nHo\p|ĐА`a  L\lxԑGJXCR| 8PDHdh(a|b40q̔3q4q5qEqDFqLyyyyAyByЕCyDy!"# 0<DT` lx ` , `  0@TĀhȀ|2"d$d%d =d0dК@TBdCx CyUUe8uLԜ   , HdН(#@$P&h'|45@BОpqr sH`l0(PDQXxԠ  4L` LĢ آ4H\pԣ !%,'@a̤hܤqxH  Pt ePfXu`vhwtx|"QR<D`@ta@L|,$PDt$D(L$pDܬ$D$1lȭЭܭ  ( 80H@XPh!\̯@BF0FAT CxF FHܱ`lԲܲ` `,@ABȴCشDEFGHI$J4KXLdMpN|OPQRST̵UصVWXYZ\ a,b@TXpXtXXX\etgȷ @$и HPW` a@0Pĺ1B2B3B4B5B 6B01G@) "$Hust,@Tl|   Ծ CxSH4Tt !  D)g :g(2h06hPrhp%i3iri$,8Hh tW ,     ,Pڀd BHCFxbeje,4 <L`h@ A! !0!BDR`%P@Hh i4xPdx(48(T(ps8801(RSXKZ`( 8HT ` pqqP0XD ,@h"#$%0&`23456   , L |C C!C"C4 2,:ghp0Xl! H X h x 08A0B0X8UL~\ `hp |(),4@ 0$,8DlTp   $0DTd t!"#$%&'(), 34(546D7TLdMp   4\t8Tp !012405D6XPlQR     ( < P! h0 1 2 @ A B P Q ,R H` da xb T%T x@xTxhx|xxxx(4<D 0@P`p0<HTdtqrrtt0xPlNC AA b*b$ c,4@@ !24+0 $@XpX , P ` | !  (        V           ( H d hq  $  ( P |  ! rL 2tX 3td 4tp Ax| 3 T    x 0   qT        ( 4 @ l  @ P E H  D h    !  @D h      @ h !x! ! ! ! ! ! ! ! ! ! ! ! ! D" E" F" G" H# I8# M\# S# T# X# Y# ]$ ^<$ nd$ v$ w$ |$ }$ ~% <% `% % % % % & 8& \& & B& B& B& C ' C' D0' DD' Dd' D' D' X' !X' P( (  ) ) ,) <) "L) #\) $l) %|) &) 2) 3) 4) 5) 6* R8* S\* T* U* V* W+ YH+ ct+ d+ e+ f+ 3, 4, 58, 6h, S, T, U, V,  - 8- `- !- "- - -  .  .  <.  l.  .  .  .  . C / D H/ E x/ F / c / d 0 e 80 f t0 0 C!0 D!0 E! 1 F!d1 c!1 d!1 e!2 f!D2 C#|2 D#2 E#2 F#83 c#x3 d#3 e#3 f#4 C$X4 D$4 E$4 F$4 c$45 d$\5 e$5 f$5 /5 46 7 07 |8 8 8 8 18 H8 H8 H8 H8 ,: : : : P; ; ; %< < 8< R0> "L> B B C (C @C XC tC C C C C D ,D PD pD D D D D E G G H H (H 8H HH XH I J tRTK ))$L I,M N 0 P ALP tS @S S  S 0T R0hT ITT T U LU V PV 6pV 2W dW LW dW |W W 9W PX hX pX X X X "X @Y A4Y xY Y Y Y Z  Z ,Z XZ dZ ilZ )tZ Z  [ [ \ !@\ X\ t\ \ \ \ ] ] (] 4] @] L] X] d] t] ] ] ] ] =] ] ] ^ ,^ dD^ d P^ (!\^ #x^ #^ #^ d#^ d$^ %^ @^ G^ `_ `_ l_ _ `@` P` ` (a La xa a a a (b Tb b  b  b  b  c  |t @t Ct Yt 0 u 1Du 2du au bu u v !v "(v #4v %) ?) @) A) B) C8*, D*D E8+l F, G- H- Il-4 J-4 Kp.t L9. M4T N 5t O5 P5 Q5 R6 S 6 T46 UD6 V6 W6 X7 Y8 Z08 [9 \9 ]49 ^9 _9 `9 a:̽ b:ܽ c:ܽ d;ܽ e;ܽ f;ܽ g0< ht< i< j0=L kD=L l?< m@d n@d o@d p@d q@d r@d s@d t8BԿ uXBܿ vxBܿ w Bܿ x D< yE zE {E |$E }LE ~lE F$ F, $GD TGL pGL GT GT GT GT GT HT  HT Ht Ht @J  ? @L AL BԙL C@t DPt Ex| F G$ H4 Iț J KX Ll Mx N O  Px Q R S T̟ U؟ V W X Yl Z [ \ ] ^L _L `L aL bġL cܡL d\ e4\ ftd gT hl i j k < l< mH< nX< op< p< q< r< sԥ< t< u< v< w(< x<< y`D zȧ {ܧ | } ~ $  @ ب     ( ة4 4  4 @4 T4 l4 D H X d   x< < L L ԮL L L L 4L HL dT T T ܯd d d 0d Pd td d d d ̰d ܰd l l  D      , @ ` x   ij    4 L l  #  Ķ Զ   $ 8  , , ,D PD lD xD D ĸD ظL L L 4\ Xl hl l l l l Թl l l H| X| p| | | к    0 P h x     ػ L ` x   ܼ P d    Ƚ ؽ   (d <d Ld `d l l ܿl l l $t 4t @t Tt dt |t ( \ x       4 4  4 l l l l l l !Tt "dt # t $4 %H 'X (d ) * + , - . / 0$ 1< 2T 3` 4p 5 6 7 8 9 : ;0 <H =` > ? @ A B0 C< D< Epl Fl Gl Hl Il Jl Kl LPt Mlt N O P Q4 SH Td Ux V W X  Y0 Zx [ \ ] ^d _d `d aH b| c d e f g< hp i| j k l m n o px q r s t uT vt w x y zP4 {4 |H }d ~t     D L L <T HT d d d d d d l       ( @ X       $ D ` x       $ 4 H d      0 H T l       P ` |         ` t < P ` p        ,  4 \ \ d d d d (d Pt `t t t t t t 8 L p                    $ 4 < ` p        ( < L $` |      $ 4 P \ d x      L     % D !D "D #D $D %D & D '$D (4D )LD *hD +xD ,D -D 0D 1D 2D 4XT 5xT 7T 8T :T ;T <T =T >T ? T @ T A,T BDT CXT DtT ET GT IT JT Kd Ld M4d N O P Q  S TP Ud V| Y Z [ \  ], ^, _d `d ad bd cd dd ed f(d g@d h\d ipd j|d kd ld md od pd qd s(l t<l uHl vXl w\l xl yl zl {l |l }l ~l 8l Tl pl l l l l < X h      ( 4 L d    P \ p    X |        4 4 4 4 4 4< `< x< < < < < < <  <  < , < < < @ < L < ` < | <  <  <  <  <  <  <  < D D  \  \  \  \  \  \  \ ( \ < \ P \ h \ | \  \  \  \  d 0 t H t X t t t  t  t  t  t  t  t ( t @ t X t t t  |  |  |  |  |  |  | $ | 8 | T | p |  |  |  |  |  |  | 0 L h |     4 T l x       $ 0 L d    $  $  ,  ,  ,  , 4 , L , d , t ,  ,  <  <  <  l  l  l @ l X l x l  l  l  l  l ! l " l # l $ l %0 l &D l '` l (| l ) l * l + l , l - l . l / l 0  l 1H l 2d l 3x l 5 l 6 l 7 l 8 l 9 l : l ; l <8 l =D l >d l ?x l @ l A l B l C l D l E l F l G l H  l I( l J 8 l K L M N O  P8 QT Sl Tx U V W X Y Z [ \( ]0 ^H _` ` a b c d e  f$ g4 h@ iX jt kx l m n o p  q0 rP sh t u v w x y z {( |< }H ~h          8 h        0 H d x       4 D \ t        $ @ d        0 < h      L , ` , | 4  4  d  d $ d D d X d l d  d  d  d  d  d  d   d  d < d T d l d | d  d  d  d  d  d  d , d      ! ,! @! `!  ! ! L " L 0" L L" L X" L d" L )l" L ' '  ( ( ( 4( t( ( ( ( ( ( T( 46 < L6 < X6 < |6 < 6 < 6 < 6 < 6 < 6 < 6 < 7 < P7 L l7 L 7 L 7 L 7 L 7 L 7 L 8 L (8 L P8 L  h8 L 8 9 <9 P9 h9 x9 9 9 9 9 9 9 9 : : \: l: : : : : ; (; 4; p; !; "; #; $; %T< &h< 't< (< )< *< +< ,< -< .= /= 0(= 1@= 2L= 3\= 4h= 5t= 7= 8= 9= := ;= <> =$> >4> ?D> @T> Ap> B> C> D> E> F? G? H(? ID? Jd? K|? L? M? N? O? P? Q@ R(@ S<@ TX@ Ut@ V@ W@ X@ Y@ Z@ [@ \A ]A ^$A _8A `LA alA bA cA dA eA fA gB hB i0B jHB kXB ldB m|B nB oB pB qB rE s(E t>>>>>l>L>8>>>=====|=h=L=0==<<<<<<<<<x<h<X<H<$<<;;;;;;;;x;t;\;H;4;$;;::::::::::|:l:T:H:D:4:$::::99999|9P9(9988888h8?$Y!4H\\4 p4 pZ!Z!DDDDcfi_cmdset_0020Ԩ Jcfi_cmdset_0002LNcfi_cmdset_0001cfi_cmdset_0003|i,,1iiH1`1x1112X22[![!KL;8>?A<=kkkkkk~~~~l|88||8<<<<~~<<<><~~<fffffffff{|`8ll8 |<~~<~<~~< 0``0(ll(88||||88<<<fff$lllllll||| 0`Ɔ8ll8vv000` 000000 0 0f<l8l||||`0||0xv`0v~ x|||||8ld`````ff<~~~p0`x |v 08<0`||0`vvffffffv~8ll8|0000`|`bfl0`܆ >`bfl0fΚ?<<<6ll6l6lDDDDDDDDUUUUUUUUwwwwwwww66666666666666666666666666666666666666666666666666666666666666666666666666666667666666666666670??07666666666666666666666666667076666666666666666666666666666666666666666666??66666666666666666666666vvxllllll`00`~pffffff|``v~ffff<~~~~`0``|```0|~~0  0~ 0`0 ~p~vv8ll8 ll<l66666dTeflnoUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU@m!Dm!Hm!dm!tm!m!Lm!Tm!\m!m!m!m!|T$$T$DT$l!m<\4@<*8" X 123 <PQRSTUVWXYZp s0t uvz  Poo!0<Php#$ %''|(d`@   d`X`]`bcdjHmLpTqHT T@ X)0'`R6) -.6::t;AABEG